SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016988 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016988
Domain Number 1 Region: 360-451
Classification Level Classification E-value
Superfamily PH domain-like 7.4e-19
Family Pleckstrin-homology domain (PH domain) 0.0094
Further Details:      
 
Domain Number 2 Region: 549-637
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-18
Family Third domain of FERM 0.004
Further Details:      
 
Domain Number 3 Region: 245-296
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000379
Family Second domain of FERM 0.0078
Further Details:      
 
Domain Number 4 Region: 464-548
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000667
Family Second domain of FERM 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016988   Gene: ENSMMUG00000012939   Transcript: ENSMMUT00000018145
Sequence length 662
Comment pep:known chromosome:MMUL_1:14:10205144:10222170:-1 gene:ENSMMUG00000012939 transcript:ENSMMUT00000018145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGMKTASGDYIDSSWELRVFVGEEDPEAESVTLRVTGESHIGGVLLKIVEQISRGETCA
FHYCVSSSQLADKGQTHISTSMPIHGSSRACTSLPQTLHLPHGRHCSMSQFSVPLGAPQN
AKQRPLNRRLREDRGGVMWREPKEAKKKEKEPEEELYDLSKVVLAGGVAPAVFRGMPAHF
SDSAQTEACYHMLSRPQPPPDPLLLQRLPRPSSLSDKTQLHSRWLDSSRCLMQQGIKAGD
VLWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDLLLEEIDCTEEEMMVFAALQYHINKLS
QSGEVGEPAGTDPGLDDLDAALSNLEVKLEGSAPTDVLDSLTTIPELKDYLRIFRGWSAP
RKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLNLKGCEVVPDVNVSGQKFCIKLL
VPSPEGMSEIYLRCQDEQQYARWMAGCRLASKGRTMADSSYASEVQAILAFLSLQRTGGG
GPGNHPQGPDASAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLAEAQLRFIQ
AWQSLPDFGISYVMVRFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNWD
IRQVAIEFDEHINVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQLTGGHE
AF
Download sequence
Identical sequences ENSMMUP00000016988 ENSMMUP00000016988 9544.ENSMMUP00000016988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]