SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017408 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017408
Domain Number 1 Region: 4-81
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.27e-16
Family THAP domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000017408
Domain Number - Region: 100-245
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.000994
Family Outer membrane efflux proteins (OEP) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017408   Gene: ENSMMUG00000013240   Transcript: ENSMMUT00000018587
Sequence length 309
Comment pep:known chromosome:MMUL_1:20:66172523:66174353:1 gene:ENSMMUG00000013240 transcript:ENSMMUT00000018587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRL
CSVHFQGGRKTYTVRVPTIFPLRGVNERKVARRPAGAAAARRRQQQQQQQQQQQQQQQQQ
QQQQQQQPSPSASTAQTSQLQPNLVSASAAVLLTLQAAVDSSQAPGSVPPTPITPTGEDV
KPIDLTVQVEFAATEGAAAAAAASELQAATAGLEAAECPMGPQLVVVGEEGFPDTGSDHS
YSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELREKDRLLAM
AVIRKKHGM
Download sequence
Identical sequences A0A2K5UNJ1 F6ZKC9
XP_005592350.1.63531 XP_014981922.1.72884 ENSMMUP00000017408 ENSMMUP00000017408 9544.ENSMMUP00000017408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]