SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017732 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017732
Domain Number 1 Region: 650-841
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-47
Family SPRY domain 0.0000421
Further Details:      
 
Domain Number 2 Region: 18-111
Classification Level Classification E-value
Superfamily RING/U-box 8.01e-30
Family RING finger domain, C3HC4 0.007
Further Details:      
 
Domain Number 3 Region: 358-444
Classification Level Classification E-value
Superfamily RING/U-box 7.51e-25
Family RING finger domain, C3HC4 0.0041
Further Details:      
 
Domain Number 4 Region: 111-175
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.88e-17
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Domain Number 5 Region: 450-504
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000397
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017732   Gene: ENSMMUG00000013490   Transcript: ENSMMUT00000018935
Sequence length 843
Comment pep:known chromosome:MMUL_1:14:67715051:67727138:-1 gene:ENSMMUG00000013490 transcript:ENSMMUT00000018935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RILQAGNILEIRARQAGARRVATMTSPVLVDIREDVTCPICLELLTEPLSIDCGHSFCQA
CITPNSRESMIGQEGERSCPVCQTSYQPGNLRPNRHLANIVRRLREVVLGPGKQLKAVLC
ADHGEKLQLFCQEHGKVICWLCERSQEHRGHHTFLVEEVAQEYQEKFQESLKKLKNEEQE
AEKLTAFIREKKTCWKARGTFSEDNQMEPERHRIQTEFNQLRNILDRVEQRELKKLEEEE
KKGLRIIEEAENDLVHQSQSLRELILDLERRCQGSTMELLQSRSRVLSRSEFWTLRKPEA
LPTKLRSMFRAPDLKRMLRVFRELTDVQSYWGKQGSLTRRERTASGVRTRRSQESSAMAS
KILLNVQEEVTCPICLELLTEPLSLGCGHSLCRACITVTNKEAVTSPGGKSSCPVCGTSY
SFENLQTNRHLTNIVERLKEVKLSSDNGKKRDLCDHHGEKLLLFCKEDRKVICWLCERSQ
EHRGHHTVLTEELFKECQGKLQAVIVLASTERKIPDKLITSLSCPSLQYQVQTERQRIQT
EFDQLRSILNSEEQRELQRLEEEEKKRLDKFAEAEDELVQQKQLVRELISDVECRSQWSA
MELLQDMSGIMKWSEIWRLKKPKKVSKKLKTVFRAPDLSRMLQMFRELTAVRCYWADVTL
NSVNLNLNLVLSEDQRQVISVPIWPFQCYNYGVLGSQYFSSGKHYWEVDVSKKTAWILGV
YCRTCSRNIKYVVRRCANHQNVYSKYRPLFGYWVIGLQNKCKYSAFEESLSSDPEVLTLS
MAVPPCRVGVFLDYEAGIVSFFNVTSHGSLIYKFSKCCFSQPVYPYFNPWNCPAPMTLCP
PSS
Download sequence
Identical sequences 9544.ENSMMUP00000036880 ENSMMUP00000017732 ENSMMUP00000036880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]