SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017751 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017751
Domain Number 1 Region: 360-550
Classification Level Classification E-value
Superfamily Fibronectin type III 3.34e-40
Family Fibronectin type III 0.00082
Further Details:      
 
Domain Number 2 Region: 246-361
Classification Level Classification E-value
Superfamily Fibronectin type III 1.3e-20
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 3 Region: 771-866
Classification Level Classification E-value
Superfamily Immunoglobulin 3.04e-20
Family I set domains 0.0072
Further Details:      
 
Domain Number 4 Region: 653-752
Classification Level Classification E-value
Superfamily Fibronectin type III 1.25e-17
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 5 Region: 75-163
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000863
Family I set domains 0.022
Further Details:      
 
Domain Number 6 Region: 172-267
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000295
Family I set domains 0.013
Further Details:      
 
Domain Number 7 Region: 559-661
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000153
Family I set domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017751   Gene: ENSMMUG00000013504   Transcript: ENSMMUT00000018954
Sequence length 868
Comment pep:known chromosome:MMUL_1:1:169265395:169279017:-1 gene:ENSMMUG00000013504 transcript:ENSMMUT00000018954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWQSMGENRGCLEEMLSEDQSREPPSHLGSRRGGKDGSLDIYGERRDATQSSTSRYKPG
TGSFSKEARGSLGHFSQGLADMKVQQGEAATLSCILTSDLGPGTWFKDGVKLTAQDGVIF
KQDGLVHSLFIARVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAG
KPVTVKIPFQSHLPVQAAWRKDGAKVVGSGDKEAQVDLGDRYTRLCLPSTGRKDSGQYSV
TLRSEGGSVQAELTLKVIDKPDPPQGPMEVQDCQRAGVCLRWRPPRDDGGQPVECYVVER
RQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYAFRVRAVTSEGAGEALESEETLVAPEAL
PKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRW
TVADLRQGCQYEFRVTAVAPPGPGEPGPPSDAVFARDPMRPPGPVRNLQVTDTSNTSITL
SWAGPDTKDGDEAQGYVVELCGSDSLQWLPCHAGTVPVTTYTAKGLRPGEGYFVRVTAVN
EGGQSQPTALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPISFEAVPMPEVTWL
KDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAVCPQA
PGPIHLQENVPGTVTAEWEPSPDEARGVPLHYTVFTRSSAHGPWREAADRIHTNRFTLLG
VLPGHEYHFRVVAKNELGASKPSYTSQPWCIPRQRDRFTVKAQSYREPDLSQKPRFLVGL
RSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLMGVCSLTIPSVSLKD
SGEYKAVAENTLGQAVSTATLIVIEPSA
Download sequence
Identical sequences ENSMMUP00000017753 ENSMMUP00000017751 9544.ENSMMUP00000017753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]