SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017773 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017773
Domain Number 1 Region: 20-197
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.91e-35
Family Laminin G-like module 0.000000165
Further Details:      
 
Domain Number 2 Region: 217-394
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.73e-16
Family Laminin G-like module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017773   Gene: ENSMMUG00000013513   Transcript: ENSMMUT00000018976
Sequence length 402
Comment pep:known chromosome:MMUL_1:16:7361348:7364591:1 gene:ENSMMUG00000013513 transcript:ENSMMUT00000018976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESRGPMATSRRLLLLLLLLLHHTHQGWALRPVLPTQRAQDPPAVHLSNGPGQEPAAVMT
FDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNYWAQLTVGA
GPRLDDGRWHQVEVKMDGDSVLLKVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLFFPAS
NLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTHAEFNLQDI
PQPHAEPWAFSLDLGLKQAVGSGHLLSLGTPENPSWLSLHLQDQKVVLSSGSGPGMDLPL
VLGLPLQLKLSMSRVVLSQGPKMEVLALPPLGLASLLNLWAKPQGRLFLGALPGEDSSTS
FCLHGLWAQGQRLDVDRALNRSHEIWTHSCPQSPGNGTDASH
Download sequence
Identical sequences F6Z7N8 G7PTI7
XP_015292846.1.63531 ENSMMUP00000017773 9544.ENSMMUP00000017773 ENSMMUP00000017773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]