SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017837 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017837
Domain Number 1 Region: 123-241
Classification Level Classification E-value
Superfamily Fibronectin type III 5.52e-28
Family Fibronectin type III 0.005
Further Details:      
 
Domain Number 2 Region: 10-45,78-148
Classification Level Classification E-value
Superfamily Fibronectin type III 1.16e-26
Family Fibronectin type III 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017837   Gene: ENSMMUG00000013562   Transcript: ENSMMUT00000019044
Sequence length 243
Comment pep:known chromosome:MMUL_1:4:126681520:126694473:1 gene:ENSMMUG00000013562 transcript:ENSMMUT00000019044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTQPAHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIMFLCNMKSSHQKPS
GCWQHTSSTENGLRQLLEYGQRQWKNKEDCWGTQELFCDLTSETSDIQEPYYGRVRAASA
GSYSDWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPQRYQKEKNISIEDYYE
LVYRVFIINNSLEKEQKVYEGAHRVVEIEALPPHSSYCVVAEIYQPMLDRRSQRSEERCV
EMP
Download sequence
Identical sequences 9544.ENSMMUP00000017837 ENSMMUP00000017837 ENSMMUP00000017837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]