SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017894 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017894
Domain Number 1 Region: 526-595
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.78e-19
Family Complement control module/SCR domain 0.00026
Further Details:      
 
Domain Number 2 Region: 275-344
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.18e-16
Family Complement control module/SCR domain 0.00055
Further Details:      
 
Domain Number 3 Region: 777-839
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.47e-16
Family Complement control module/SCR domain 0.00049
Further Details:      
 
Domain Number 4 Region: 350-420
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000125
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 5 Region: 154-225
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000195
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 6 Region: 911-975
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000025
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 7 Region: 662-724
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000264
Family Complement control module/SCR domain 0.00054
Further Details:      
 
Domain Number 8 Region: 410-473
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000264
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 9 Region: 21-83
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000202
Family Complement control module/SCR domain 0.0000384
Further Details:      
 
Domain Number 10 Region: 600-664
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000959
Family Complement control module/SCR domain 0.00051
Further Details:      
 
Domain Number 11 Region: 965-1029
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000032
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 12 Region: 846-905
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000556
Family Complement control module/SCR domain 0.00082
Further Details:      
 
Domain Number 13 Region: 215-286
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000648
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 14 Region: 88-150
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000737
Family Complement control module/SCR domain 0.0000348
Further Details:      
 
Domain Number 15 Region: 741-788
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000128
Family Complement control module/SCR domain 0.0044
Further Details:      
 
Domain Number 16 Region: 492-537
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000792
Family Complement control module/SCR domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017894   Gene: ENSMMUG00000013602   Transcript: ENSMMUT00000019104
Sequence length 1054
Comment pep:known chromosome:MMUL_1:1:162868199:162906983:-1 gene:ENSMMUG00000013602 transcript:ENSMMUT00000019104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAGLLGVFLALIVPGVLGISCGSPPPILNGRISHYSTPITLGTVIRYICSNGFRLIGE
KNIICITKDKVVGIWDKPAPKCEYFNKYSTCPEPIVPGGYKARGAEPPYIHGDFVTFACK
TNFSMNGNKSVWCQANNKWGPTRLPTCESVFPLECPALPMIHNGHHTRENVGSIAPGLSV
TYSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKPLGRFPNGKVKEPPILQVGVTAN
FFCDEGYQLQGPSSSRCVIAGQGVAWTKMPVCKEIFCPSPPPILNGRHTGNSLANVSYGS
IVTYTCDPDPEEGVNFILIGENTLRCTVDSQKTGTWSGPAPRCELSTSAVQCPRPQVLRG
RIVSGQKDRYTYNDTVIFACTFGFTLKGSKQIRCNAQGTWEPSAPVCEKECQAPPNILNG
QKEDRHMVRFNPGTSIKYSCNPGYVLVREESIQCTSEGVWTPPVPQCKVAVCEATGKQLL
TKPQHQFIRPDVNSSCDEGYKLSGSVYQECQGRTPWFMEIRLCKEITCPPPPVIYNGAHT
GSSLEDFPYGTTVTYTCNPGPEREVEFSLIGESTIRCTSNDQERGTWSGPAPLCELSLLA
VQCSHVHVANGYKISGKEAPYFYNDTVTFKCFNGFTLKGSSQIRCKANNTWDPEIPVCEK
GCQPPPGLHHGRHTGGNTVFFVSGMTVDYTCDPGYLLVGNKSIHCMPSGNWSPSAPRCEE
TCQPVREDLQELPVGSRVELVNTSCQDGYWLTGHTYHKCKDDENGIWFKKIPLCKVIHCH
PPPVIVNGKHTGMKAENFLYGNEVSYECDQGFYLLGEKKLQCRSDSKGHGSWSGPSPQCL
QSPPVTSCPNPEVKHGYKLNKTLSAYSHDDIVYVDCHPGFIMNGSRVIRCHTDNTWVPGV
PTCIKKAFVGCQPPPKTPNGNHTGGNIARFSPGMSILYSCDQGYLLVGEALLLCTHEGTW
NRPAPHCKEVNCSSPADMDGIQKGLEPRKMYQYGAVVTLECEDGYMLEGSSQSQCQADHQ
WNPPLAVCRSRSLAPVLSGIAAGLILLIFLIVVY
Download sequence
Identical sequences ENSMMUP00000017894 9544.ENSMMUP00000017894 ENSMMUP00000017894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]