SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018078 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018078
Domain Number 1 Region: 566-654
Classification Level Classification E-value
Superfamily PH domain-like 3.81e-18
Family Third domain of FERM 0.0045
Further Details:      
 
Domain Number 2 Region: 380-473
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-18
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 3 Region: 285-331,503-565
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000119
Family Second domain of FERM 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000018078
Domain Number - Region: 25-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00112
Family Ubiquitin-related 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018078   Gene: ENSMMUG00000013749   Transcript: ENSMMUT00000019306
Sequence length 677
Comment pep:known chromosome:MMUL_1:10:39377720:39427046:-1 gene:ENSMMUG00000013749 transcript:ENSMMUT00000019306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSTDFTSASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQINISQDWSDFA
LWWEQKHCWLLKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNLKMVRLRVSFSAVVFKA
VSDICKILNIRRSEELSLLKPSGDYFKKKKKKDKNNKEPIIEDVLNLESSPTASGSSVSP
GLYSKTMTPIYDPINGTPVSSTMTWFSDSPLTEQNCSILAFSQPPESPEALADMYQPRSL
VDKAKLNAGWLDSSRSLMEQGIQEDEQLLLRFKYYSFFDLNPKYDAVRINQLYEQARWAI
LLEEIDCTEEEMLIFAALQYHISKLSLSAETQDFTSESEVDEIEAALSNLEVTLEGGKAD
SLLEDITDIPKLADNLKLFRPKKLLLKAFKQYWFVFKDTSIAYFKNKELEQGEPVKKLNL
RGCEVVPDVNVAGRKFGIKLLIPVADGMNEMYLRCDHENQYAQWMAACMLASKGKTMADS
SYQPEVLNILSFLRMKNRNSASQVASSLENMDMKPECFVSPRCAKKHKSKQLAARILEAH
QNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVSYNRLIKIDAATGIP
VTTWRFTNIKQWNVNWETRQVVIEFDQNVFTAFTCLSADCKIVHEYIGGYIFLSTRSKDQ
NETLDEDLFHKLTGGQD
Download sequence
Identical sequences ENSMMUP00000018078 9544.ENSMMUP00000018078 ENSMMUP00000018078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]