SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019339 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019339
Domain Number 1 Region: 180-362
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.22e-29
Family Laminin G-like module 0.0038
Further Details:      
 
Domain Number 2 Region: 2-117
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.31e-17
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 119-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000221
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019339   Gene: ENSMMUG00000014734   Transcript: ENSMMUT00000020666
Sequence length 387
Comment pep:known chromosome:MMUL_1:4:60148353:60149516:-1 gene:ENSMMUG00000014734 transcript:ENSMMUT00000020666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLRYNLGDRTIILETLQKVTINGSTWHIIKAGRVGAEGYLDLDGINVTEKASTKMSSLDT
NTDFYIGGVSSLNLVNPMAIENEPVGFHGCIRQVIINNQELQLTEFGAKGGSNVGDCDGT
ACGYNTCRNGGECTVNGTTFSCRCLPDWAGNICNQSAYCLNNLCLHQSLCIPDQSFSYSC
LCTLGWVGRYCENKTSFTTAKFMGNSYIKYIDPNYRMRNLQFTTISLNFSTTKTEGLIIW
MGIAQNEENDFLAIGLHNQTLKIAVNLGERISVPMSYNNGTFCCNKWHHVIVIQNQTLIK
AYVNNSLILSEDIDPHKNFVALNYEGICYLGGFEYGRKVNIVTQEIFKTNFVGKIKDVVF
FQDPKKIELIKLEGYNVYDGDEQNEVT
Download sequence
Identical sequences ENSMMUP00000019339 9544.ENSMMUP00000019339 ENSMMUP00000019339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]