SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019667 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019667
Domain Number 1 Region: 755-1052
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.16e-67
Family Tandem AAA-ATPase domain 0.0000761
Further Details:      
 
Domain Number 2 Region: 480-753
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.78e-59
Family Tandem AAA-ATPase domain 0.0000322
Further Details:      
 
Domain Number 3 Region: 2030-2093
Classification Level Classification E-value
Superfamily BRK domain-like 9.16e-17
Family BRK domain-like 0.0000155
Further Details:      
 
Domain Number 4 Region: 359-423
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000000000923
Family Chromo domain 0.023
Further Details:      
 
Domain Number 5 Region: 435-498
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000782
Family Chromo domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019667   Gene: ENSMMUG00000015002   Transcript: ENSMMUT00000021033
Sequence length 2301
Comment pep:known chromosome:MMUL_1:7:84114383:84163197:-1 gene:ENSMMUG00000015002 transcript:ENSMMUT00000021033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGESKRITLVLQQPQSGGPQGHRHVVLGSLPGKIVLQGNQLAALTQAKNAQGQPAKVVT
IQLQVQQPQQKIQIVPQPPSSQPQPQQPPSTQPVTLSSVQQAQIMGPGQSPGQRLSVPVK
VVLQPQAGSSQGASSGLSVVKVLSASEVAALSSPASSAPHSGGKTGMEENRRLEHQKKQE
KANRIVAEAIARARARGEQNIPRVLNEDELPSVRPEEEGEKKRRKKSAGERLKEEKPKKN
KTSGTSKTKGKSKLNTITPVVGKKRKRNTSSDNSDVEVMPAQSPREDEESSIQKRRSNRQ
VKRKKYTEDLDIKITDDEEEEEVDVTGPIKPEPILPEPVQEPDGETLPSMQFFVENPSEE
DAAIVDKVLSMRIVKKELPSGQYTEAEEFFVKYKNYSYLHCEWATISQLEKDKRIHQKLK
RFKTKMAQMRHFFHEDEEPFNPDYVEVDRILDESHSIDKDNGEPVIYYLVKWCSLPYEDS
TWELKEDVDEGKIREFKRIQSRHPELKRVNRPQASAWKKLELSHEYKNRNQLREYQLEGV
NWLLFNWYNRQNCILADEMGLGKTIQSIAFLQEVYNVGIHGPFLVIAPLSTITNWEREFN
TWTEMNTIVYHGSLASRQMIQQYEMYCKDSRGRLIPGAYKFDALITTFEMILSDCPELRE
IEWRCVIIDEAHRLKNRNCKLLDSLKHMDLEHKVLLTGTPLQNTVEELFSLLHFLEPSQF
PSESEFLKDFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKNLAPKQETIIEVELTNIQKK
YYRAILEKNFSFLSKGAGHTNMPNLLNTMMELRKCCNHPYLINGAEEKILTEFREACHII
PHDFHLQAMVRSAGKLVLIDKLLPKLKAGGHKVLIFSQMVRCLDILEDYLIQRRYLYERI
DGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQA
QARCHRIGQSKAVKVYRLITRNSYEREMFDKASLKLGLDKAVLQSMSGRDGNITGIQQFS
KKEIEDLLRKGAYAAIMEEDDEGSKFCEEDIDQILLRRTTTITIESEGKGSTFAKASFVA
SENRTDISLDDPNFWQKWAKKADLDMDLLNSKNNLVIDTPRVRKQTRHFSTLKDDDLVEF
SDLESEDDERPRSRRHDRHHAYGRTDCFRVEKHLLVYGWGRWRDILSHGRFKRRMTERDV
ETICRAILVYCLLHYRGDENIKGFIWDLISPAENGKTKELQNHSGLSIPVPRGRKGKKVK
SQSTFDIHKADWIRKYNPDTLFQDESYKKHLKHQCNKVLLRVRMLYYLRQEVIGDQAEKV
LGGAIASEIDIWFPVVDQLEVPTTWWDSEADKSLLIGVFKHGYEKYNTMRADPALCFLEK
AGRPDDKAIAAEHRVLDNFSDIVEGVDFDKDCEDPEYKPLQGPPKDQDDEGDPLMMMDEE
ISVIDGDEAQVTQQPGHLFWPPGSALTARLRRLVTAYQRSYKREQMKIEAAERGDRRRRR
CEAAFKLKEIARREKQQRWTRREQTDFYRVVSTFGVEYDPDTMQFHWDRFRTFARLDKKT
DESLTKYFHGFVAMCRQVCRLPPAAGDEPPDPNLFIEPITEERASRTLYRIELLRRLREQ
VLCHPLLEDRLALCQPPGPELPKWWEPVRHDGELLRGAARHGVSQTDCNIMQDPDFSFLA
ARMNYMQNHQAGAPAPSLSRCSTPLLHQQYTSRTASPLPLRPDAPVEKSPEETAAQVPSL
ESLTLKLEHEVVARSRPTPQDYEMRVAPSDTTPLVSRSVPPVKLEDEDDSDSELDLSKLS
PSSSSSSSSSSSSSSTDESEDEKEEKLTDQSRSKLYDEESLLSLTMSQDGFPNEDGEQMT
PELLLLQERQRASEWPKDRVLINRIDLVCQAVLSGKWPSSRRSQEMVTGGILGPGNHLLD
SPSLTPGEYGDSPVPTPRSSSAASMAEEEASAVTTAAAQFTKLRRGIDEKEFTVQIKDEE
GLKLTFQKHKLMANGVMGDGHPLFHKKKGNRKKLVELEVECMEEPNHLDVDLETRIPVIN
KVDGTLLVGEDAPRRAELEMWLQGHPEFAVDPRFLAYMEDRRKQKWQRCKKNNKAELNCL
GMEPVQTANSRNGKKGHHTETVFNRVLPGPIAPESSKKRARRMRPDLSKMMALMQGGSTG
SLSLHNTFQHSSSGLQSVSSLGHSSATSASLPFMPFVMGGAASSPHVDSSTMLHHHHHHP
HPHHHHHHHPGLRAPGYPSSPATTASGTTLRLPPLQPEEDDDDEEDDDDLSQGYDSSERD
FSLIDDPMMPANSDSSEDADD
Download sequence
Identical sequences F6VDD8
XP_001096619.2.72884 ENSMMUP00000019667 9544.ENSMMUP00000019667 ENSMMUP00000019667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]