SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019807 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019807
Domain Number 1 Region: 745-919
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-41
Family MAM domain 0.00031
Further Details:      
 
Domain Number 2 Region: 441-541
Classification Level Classification E-value
Superfamily Immunoglobulin 4.27e-17
Family I set domains 0.036
Further Details:      
 
Domain Number 3 Region: 241-328
Classification Level Classification E-value
Superfamily Immunoglobulin 5.84e-16
Family I set domains 0.014
Further Details:      
 
Domain Number 4 Region: 48-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000154
Family I set domains 0.04
Further Details:      
 
Domain Number 5 Region: 346-427
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000334
Family I set domains 0.018
Further Details:      
 
Domain Number 6 Region: 152-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000883
Family I set domains 0.035
Further Details:      
 
Domain Number 7 Region: 536-627
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000112
Family I set domains 0.034
Further Details:      
 
Domain Number 8 Region: 652-729
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000356
Family Fibronectin type III 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019807   Gene: ENSMMUG00000015110   Transcript: ENSMMUT00000021181
Sequence length 956
Comment pep:known chromosome:MMUL_1:7:109926961:110375316:-1 gene:ENSMMUG00000015110 transcript:ENSMMUT00000021181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLLYGLVWLLTVLLEGISGQGVYAPPTVRIVHSGLACNIEEERYSERVYTIREGETLEL
TCLVTGHPRPQIRWTKTAGSASDRFQDSSVFNETLRITNIQRHQGGRYYCKAENGLGSPA
IKSIRVDVYYLDDPVVTVHQSIGEAKEQFYYERTVFLRCVANSNPPVRYSWRRGQEVLLQ
GSDKGVEIYEPFFTQGETKILKLKNLRPQDYANYSCIASVRNVCNIPDKMVSFRLSNKTA
SPSIKLLVDDPIVVNPGEAITLVCVTTGGEPAPSLTWVRSFGTLPEKTVLNGGTLTIPAI
TSDDAGTYSCIANNNVGNPAKKSTNIIVRALKKGRFWITPDPYHKDDNIQIGREVKISCQ
VEAVPSEELTFSWFKNGRPLRSSERMVITQTDPDVSPGTTNLDIIDLKFTDFGTYTCVAS
LKGGGISDISIDVNISSSTVPPNLTVPQEKSPLVTREGDTIELQCQVTGKPKPIILWSRA
DKEVAMPDGSMQMESYDGTLRIVNVSREMSGMYRCQTSQYNGFNVKPREALVQLIVQYPP
AVEPAFLEIRQGQDRSVTMSCRVLRAYPIRVLTYEWRLGNKLLRTGQFDSQEYTEYPVKS
LSNENYGVYNCSIINEAGAGRCSFLVTGKAYAPEFYYDTYNPVWQNRHRVYSYSLQWTQM
NPDAVDRIVAYRLGIRQAGQQRWWEQEIKINGNIQKGELITYNLTELIKPEAYEVRLTPL
TKFGEGDSTIRVIKYSAPVNPHLREFHCGFEDGNICLFTQDDTDNFDWTKQSTATRNTKY
TPNTGPNADRSGSKEGFYMYIETSRPRLEGEKARLLSPVFSIAPKNPYGPTNTAYCFSFF
YHMYGQHIGVLNVYLRLKGQTTIENPLWSSSGNKGQRWNEAHVNIYPITSFQLIFEGIRG
PGIEGDIAIDDVSIAEGECAKQDLATKNSVDGAVGILVHIWLFPIIVLISILSPRR
Download sequence
Identical sequences F6UV60
ENSMMUP00000019807 ENSMMUP00000019806 9544.ENSMMUP00000019806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]