SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020553 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020553
Domain Number 1 Region: 865-1169
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.09e-93
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000483
Further Details:      
 
Domain Number 2 Region: 1127-1428
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.07e-79
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000148
Further Details:      
 
Domain Number 3 Region: 373-572
Classification Level Classification E-value
Superfamily Fibronectin type III 5.88e-28
Family Fibronectin type III 0.00079
Further Details:      
 
Domain Number 4 Region: 25-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-27
Family MAM domain 0.0000163
Further Details:      
 
Domain Number 5 Region: 271-408
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000136
Family Fibronectin type III 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020553   Gene: ENSMMUG00000015661   Transcript: ENSMMUT00000021974
Sequence length 1433
Comment pep:known chromosome:MMUL_1:1:31978596:32070365:1 gene:ENSMMUG00000015661 transcript:ENSMMUT00000021974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAQALVLALTFQLCAPETETPAAGCTFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGT
RAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDGHSPGTLGVY
VRVNGGPLGSAVWNMTGSHGRQWHQAELAVSTFWPNEYQVGWVQSAASLCLEVGQMDVSL
RSEQPLVKARGQVTVQDLDGNSGSTLFTMGAGIPLPTSWLGRERQCDGHLPRQGWRDISM
TGAFPPPPGALGAGVSQQHRSAPPLPHLLAEPPTPIAPPQLLRAGPTYLIIQLNTNSIIG
DGPIVRKEIEYRMARGPWAEVHAVSLQTYKLWHLDPDTEYEISVLLTRPGDGGTGRPGPP
LISRTKCAEPMRAPKGLAFAEIQARQLTLQWEPLGYNVTRCHTYTVSLCYHYILGSSHNQ
TIRECVKTEQGVSRYTIKNLLPYRNVHVRLVLTNPEGRKEGKEVTFQTDEDVPGGIAAES
LTFTPLEDMIFLKWEEPQEPNGLITQYEISYQSIESSDPAVNVPGPRRTISKLRNETYHV
FSNLHPGTTYLFSVRARTGKGFGQAALTEITTNISAPSFDYADMPSPLGESENTITVLLR
PAQGRGAPISVYQVIVEEERARRLRREPGGQDCFPVPLTFEAALARGLVHYFGAELAASS
LPEAMPFTVGDNQTYRGFWNPPLEPRKAYLIYFQAASHLKGETRLNCIRIARKAACKESK
RPLEVSQRSEEMGLILGICAGGLAVLILLLGAIIVIIRKGRDHYAYSYYPKPVNMTKATV
NYRQEKTHMMSAVDRSFTDQSTLQEDERLGLSFMDTHGYSTRGDQRSGGVTEASSLLGGS
PRRPCGRKGSPYHTGQLHPAVRVADLLQHINQMKTAEGYGFKQEYESFFEGWDATKKKDK
VKGSRQEPMPAYDRHRVKLHPMLGDPNADYINANYIDGYHRSNHFIATQGPKPEMVYDFW
RMVWQEHCSSIVMITKLVEVGRVKCSRYWPEDSDTYGDIKITLVKTETLAEYVVRTFALE
RRGYSARHEVRQFHFTAWPEHGVPYHATGLLAFIRRVKASTPPDAGPIVIHCSAGTGRTG
CYIVLDVMLDMAECEGVVDIYNCVKTLCSRRVNMIQTEEQYIFIHDAILEACLCGETTIP
VSEFKATYKEMIRIDPQSNSSQLREEFQTLNSVTPPLDVEECSIALLPRNRDKNRSMDVL
PPDRCLPFLISTDGDPNNYINAALTDSYTRSAAFIVTLHPLQSTTPDFWRLVYDYGCTSI
VMLNQLNQSNSAWPCLQYWPEPGRQQYGLMEVEFMSGTADEDLVARVFRVQNISRLQEGH
LLVRHFQFLRWSAYRDTPDSKKAFLHLLAEVDKWQAESGDGRTIVHCLNGGGRSGTFCAC
STVLEMIRCHNLVDVFFAAKTLRNYKPNMVETMDQYHFCYDVALEYLEGLESR
Download sequence
Identical sequences ENSMMUP00000020551 ENSMMUP00000020553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]