SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020803 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020803
Domain Number 1 Region: 154-347
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.18e-42
Family Astacin 0.00025
Further Details:      
 
Domain Number 2 Region: 619-729
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-37
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 3 Region: 780-886
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-36
Family Spermadhesin, CUB domain 0.0002
Further Details:      
 
Domain Number 4 Region: 469-572
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-36
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 5 Region: 354-463
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-35
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 6 Region: 910-1003
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-29
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 7 Region: 574-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 8 Region: 730-772
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000795
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020803   Gene: ENSMMUG00000015826   Transcript: ENSMMUT00000022234
Sequence length 1014
Comment pep:known chromosome:MMUL_1:9:95908201:96052483:-1 gene:ENSMMUG00000015826 transcript:ENSMMUT00000022234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRATALGALVSLLLLLPLPRGDGGLGERPDATADYSALDGEEGTEQQLEHYHDPCKAAV
FWGDIALDEDDLKLFHIDKVRDWTKQTVGATGHSTGGFEEQASESSPNATATDTGTKEAG
KDGQENTTLLHSPGTSHATVETFSPRVRRATTSRTERIWPGGVIPYVIGGNFTGQKLAKI
ILTTHHHHHNKINFRRKTVDKPLVTESQRSKYCCSYVGRRGGGPQAISIGKNCDKFGIVA
HELGHVVGFWHEHTRPDRDQHVTIIRENIQPGKEASMLIAEYGAMTVLGETYDFDSIMHY
ARNTFSRGVFLDTILPRRDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACGETLQDTTGN
FSAPGFPNGYPSYSHCVWRISVTPGEKIVLNFTSMDLFKSRLCWYDYVEVRDGYWRKAPL
LGRFCGDKVPEPLVSTDSRLWVEFRSSSNILGKGFFAVYEATCGGDINKDAGQIQSPNYP
DDYRPSKECVWRITVSEGFHVGLTFQAFEIERHDSCAYDYLEIRDGPTEESALIGHFCGY
EKPEDVKSSSNRLWMKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEHRCVNTLGSYKC
ACDPGYELAADKKMCEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQ
FEVFELEGNDVCKYDFVEVRSGLSPDAKLHGKFCGSETPEVITSQSNNMRVEFKSDNTVS
KRGFRAHFFSDKDECAKDNGGCQHECANTFGSYLCRCRNGYRLHENGHDCKEAGCAHKIS
SAEGTLASPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQHQECAYDHLEMYDGPD
SLAPILGRFCGSKKPDPMVASGSSMFLRFYSDASVQRKGFQAVHSTECGGRLKAEVQTKE
LYSHAQFGDNNYPSQAHCDWVIVAEDGYGVELTFRTFEVEEEADCGYDYMEAYDGYDSSA
PRLGRFCGSGPLEEIYSAGDSLMIRFHTDDTISKKGFHARYTSTKFQDALHMKK
Download sequence
Identical sequences 9544.ENSMMUP00000020803 ENSMMUP00000020803 ENSMMUP00000020803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]