SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020962 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020962
Domain Number 1 Region: 140-269
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.14e-25
Family Voltage-gated potassium channels 0.0032
Further Details:      
 
Domain Number 2 Region: 7-34,74-140
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-23
Family Voltage-gated potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020962   Gene: ENSMMUG00000015933   Transcript: ENSMMUT00000022403
Sequence length 341
Comment pep:known chromosome:MMUL_1:13:26635356:26673650:1 gene:ENSMMUG00000015933 transcript:ENSMMUT00000022403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPELIERQRLELRQQELRARYNLSQGGYE
ELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPL
TLVMFQSLGERINTLVRYLLHRAKKGLGMRRADVSMANMVLIGFFSCISTLCIGAAAFSH
YEHWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLN
LVVLRFMTMNAEDEKRDAEHRALLTRNGQAGCGGGGGSAHTTDTASSTAAAGGGGFRNVY
AEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVE
Download sequence
Identical sequences ENSMMUP00000020962 9544.ENSMMUP00000020962 ENSMMUP00000020962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]