SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021034 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021034
Domain Number 1 Region: 160-265
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000241
Family V set domains (antibody variable domain-like) 0.017
Further Details:      
 
Domain Number 2 Region: 41-159
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000026
Family V set domains (antibody variable domain-like) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021034   Gene: ENSMMUG00000015993   Transcript: ENSMMUT00000022484
Sequence length 342
Comment pep:known chromosome:MMUL_1:10:34738280:34755058:-1 gene:ENSMMUG00000015993 transcript:ENSMMUT00000022484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSMMLAPACLACLSPCFLLLVLVLVPSDASGQSSRNDGQVLQPEGPMLVAEGETLLLRC
MVVSSCADGMIKWVKVSTKDQQEIYNFKRGSFPGVIPMIQRTSEPLNCDYSIYIHNVTKE
HTGTYHCVRFDGLSEYSEMKSDEGTSVLVKGAGDPEPDLWIIQPQELVLGTTGGTVFLNC
TVLGDGPPGPIRWFQGAGVSREAIYNFGGISHPKATAVRASNNDFSILLQNVSSEDAGTY
YCVKFQRKPNRQYLSGQGTRLKVKAKSTSSQEAEFTSEHATEMSPTGLLVVFAPVVLGLK
AITLAALLLALATSRRSPGQEDVKTTDPAEAMNTLAWSKGQE
Download sequence
Identical sequences A0A2K5VZ41 G7N2R6
ENSMMUP00000021034 9544.ENSMMUP00000021034 ENSMMUP00000021034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]