SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021277 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021277
Domain Number 1 Region: 2-175
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-55
Family Lectin leg-like 0.0000517
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021277   Gene: ENSMMUG00000016192   Transcript: ENSMMUT00000022748
Sequence length 252
Comment pep:known chromosome:MMUL_1:6:173849924:173856521:-1 gene:ENSMMUG00000016192 transcript:ENSMMUT00000022748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTY
PNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRL
TVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDE
ESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFLLLLCALLGIVVCAVVGAVV
FQKRQERNKRFY
Download sequence
Identical sequences ENSMMUP00000021277 9544.ENSMMUP00000021277 ENSMMUP00000021277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]