SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021657 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021657
Domain Number 1 Region: 234-314
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000114
Family DEATH domain, DD 0.024
Further Details:      
 
Domain Number 2 Region: 60-110
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000198
Family TNF receptor-like 0.0063
Further Details:      
 
Domain Number 3 Region: 130-187
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000114
Family TNF receptor-like 0.0023
Further Details:      
 
Domain Number 4 Region: 320-398
Classification Level Classification E-value
Superfamily DEATH domain 0.00000111
Family DEATH domain, DD 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021657   Gene: ENSMMUG00000016485   Transcript: ENSMMUT00000023150
Sequence length 428
Comment pep:known chromosome:MMUL_1:8:121445002:121473125:-1 gene:ENSMMUG00000016485 transcript:ENSMMUT00000023150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSARAAETHRSARPAAASKRLRFPGTTMNKLLCCALVFLDISIKWTTQETFPPKYLHYDQ
ETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYV
KQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNE
TSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPT
KFTPNWLSVLVDNLPGTKVNAESVERIKRRHSSQEQTFQLLKLWKHQNKDQDIVKKIIQD
IDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTTKACKPSDQILKLLSLWR
IKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQV
QSVKISCL
Download sequence
Identical sequences A0A096N1R7 A0A2K5W5R9 A0A2K6DAV7 F7G7U5
XP_001096915.1.72884 XP_005564033.1.63531 XP_011717067.1.29376 ENSPANP00000006249 9544.ENSMMUP00000021657 ENSMMUP00000021657 ENSMMUP00000021657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]