SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021769 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021769
Domain Number 1 Region: 115-306
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.05e-87
Family p53 DNA-binding domain-like 0.000000531
Further Details:      
 
Domain Number 2 Region: 487-551
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000558
Family SAM (sterile alpha motif) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 346-386
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.000000000000497
Family p53 tetramerization domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021769   Gene: ENSMMUG00000016569   Transcript: ENSMMUT00000023268
Sequence length 635
Comment pep:known chromosome:MMUL_1:1:6636050:6691684:1 gene:ENSMMUG00000016569 transcript:ENSMMUT00000023268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSTTTSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTS
VMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIPSNTD
YPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPV
YKKAEHVTDIVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPY
EPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLETRDGQVLGRRSFEGRICACPGR
DRKADEDHYREQQALNESSTKNGAAGKRAFKQSPPAVPALGPGVKKRRHGDEDTYYLQVR
GRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRPSHLQPPSYGPVLSPMNKVHGG
MNKLPSVNQLVGQPPPHSSAATPNLGPVGAGMLNNHGHAVPANGEMSSSHSTQSMVSGSH
CTPPPPYHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIELIAGTMIKQPRACL
WPGAADRDEGHTLSQLQQLLRSSNAAAISIGGSGELQRQRVMEAVHFRVRHTITIPNRGG
PGAGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH
Download sequence
Identical sequences ENSMMUP00000021769 ENSMMUP00000021768 9544.ENSMMUP00000021768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]