SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021791 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021791
Domain Number 1 Region: 728-917
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.4e-61
Family Nucleotide and nucleoside kinases 0.0000000604
Further Details:      
 
Domain Number 2 Region: 550-664,722-756
Classification Level Classification E-value
Superfamily SH3-domain 9.98e-33
Family SH3-domain 0.0000508
Further Details:      
 
Domain Number 3 Region: 450-547
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-30
Family PDZ domain 0.000025
Further Details:      
 
Domain Number 4 Region: 200-306
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-29
Family PDZ domain 0.000023
Further Details:      
 
Domain Number 5 Region: 308-401
Classification Level Classification E-value
Superfamily PDZ domain-like 1.29e-26
Family PDZ domain 0.0000464
Further Details:      
 
Domain Number 6 Region: 1-57
Classification Level Classification E-value
Superfamily L27 domain 2.12e-20
Family L27 domain 0.00005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021791   Gene: ENSMMUG00000016585   Transcript: ENSMMUT00000023290
Sequence length 920
Comment pep:known chromosome:MMUL_1:2:188102149:188380292:1 gene:ENSMMUG00000016585 transcript:ENSMMUT00000023290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKC
IDRSKLSEPIQPVNTWEISSLPSSTVTSETLPSSLSPSVEKYRYQDEDTPPQEHISPQIT
NEVVGPELVHVSEKNLSEIENVHGFVSHSHISPIKPTEAVLPSPPTVPVIPVLPVPAENT
VILPTIPQANPPPVLVNTDSLETPTYVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPH
IGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLY
VKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQ
IGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQP
VDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVILHRGSTGLGFNIVGGEDG
EGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR
PEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRALFDYDKTKDSGLPSQGLN
FKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKFNSKTRD
KGQSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQHVTSNASDSESSYRGQEEYVLSYE
PVNQQEVNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVT
SREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLY
PISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQV
KQIIEEQSGSYIWVPAKEKL
Download sequence
Identical sequences ENSMMUP00000021791 ENSMMUP00000021791 9544.ENSMMUP00000021791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]