SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021984 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021984
Domain Number 1 Region: 326-454
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-17
Family Cadherin 0.00099
Further Details:      
 
Domain Number 2 Region: 122-233
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000002
Family Cadherin 0.00042
Further Details:      
 
Domain Number 3 Region: 444-557
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000011
Family Cadherin 0.0021
Further Details:      
 
Domain Number 4 Region: 563-662
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000243
Family Cadherin 0.0051
Further Details:      
 
Domain Number 5 Region: 260-338
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000728
Family Cadherin 0.0022
Further Details:      
 
Domain Number 6 Region: 66-128
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000271
Family Cadherin 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021984   Gene: ENSMMUG00000016727   Transcript: ENSMMUT00000023498
Sequence length 831
Comment pep:known chromosome:MMUL_1:20:65198849:65208830:-1 gene:ENSMMUG00000016727 transcript:ENSMMUT00000023498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPAWLWLLCISVPQALPSSCCFSLKPCFPESYTCYTGYPCYPHQLLLPREGAEGQIMLS
GDSGKAAQGPFAMDPDSGFLLVTRALDREEQAEYQLQVTLETQDRRVLWGPQPVLVRVKD
ENDQVPHFSQAIYRAQLSRGTRPGIPFLFLEASDQDEPGTANSDLRFRILSQAPAQPFPD
MFQLEPRQGALALSPKGSTSLDHALEKTYQLLVQVKDMGDQASGHQAIATVEVSIIESTW
VPLEPIHLAENLKVLYPHHIAQVHWSGVDVHYRLESHPLGPFDVDAEGNLYVTRELDTEA
QAEYVLQVWAQNSRGEDYAAPLELHVLVMDENDNVPVCPPRGPAVSIPELSPPGTEVTRL
SAEDADAPGSPNSHIVYQLLNPESEDGVEGRAFQVDSTSGSVTLGALPLQAGQNILLLVL
AMDLAGAEGGFSSTCEVEVEVTDINDHAPEFTTSQIGPISLPEDVEPGTLVAMLTATDAD
LEPAFRLMDFAIERGDMDGTFDLDWEPDSGHVGLRLCKNLSYEAAPSHKVVVVVRSVAEL
VGPGPGPGATATVTVLVERVMPPPKLDQERYEASVPISAPAGSLLLTIQPSDPISRSLRF
SLVNDSEGWLCIEKVSGEVHTAQSLQGTQPGDTYTVLVEAQDTDEPRLSTSVPLVIHFLK
APPAPALTPAPVPSRYLCTPRQDHGVIVSGPSKDSDLASGHGPYSFALGPNPTVQRDWRL
QTLNGSHAYLTLALHWVEPREHIIPVVVSHNAQMWQLLVRVIVCRCNVEGQCMRKVGRMK
GMPTKLSAVGILVGTLVAIGIFLILIFTHWTLSRKKDLNQPADSVPLKATV
Download sequence
Identical sequences 9544.ENSMMUP00000021985 ENSMMUP00000021985 ENSMMUP00000021984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]