SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022120 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022120
Domain Number 1 Region: 445-506
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000212
Family LIM domain 0.0028
Further Details:      
 
Domain Number 2 Region: 503-573
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000343
Family LIM domain 0.0025
Further Details:      
 
Domain Number 3 Region: 417-443
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000186
Family LIM domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022120   Gene: ENSMMUG00000016823   Transcript: ENSMMUT00000023639
Sequence length 613
Comment pep:known chromosome:MMUL_1:2:180737557:181209782:1 gene:ENSMMUG00000016823 transcript:ENSMMUT00000023639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHPSWLPPKSTGEPLGHVPARMETTHSFGNPSISVSTQQPPKKFAPVVAPKPKYNPYKQ
PGGEGDFLPPPPPPLDDSSALPSISGNFPPPPPLDEEAFKVQQGNPGGKTLEERRSSLDA
EIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVSTPVTGHKRMVIPNQPPLTATKKST
LKPQPAPQAGPIPVAPIGTLKPQPQPVPASYTTASTSSRPTFNVQVKSAQPSPHYMAAPS
SGQIYGSGPQGYNTQPVPVSGQCPPPSTRGGMDYAYIPPPGLQPEPGYGYTPNQGRYYEG
YYAAGPGYGGRNDSDPAYGQQGHPNTWKREPGYTPPGAGNQNPPGMYPVTGPKKTYITDP
VSAPCAPPLQSKGGHTGQLGPSSVPPSLRPEDELEHLTKKMLYDMQNPPADEYFGRCARC
GENVVGEGTGCTAMDQVFHVDCFTCIICNNKLRGQPFYAVEKKAYCEPCYINTLEQCNVC
SKPIMERILRATGKAYHPHCFTCVMCHRSLDGIPFTVDAGGLIHCIEDFHKKFAPRCSVC
KEPIMPAPGQEETVRIVALDRDFHVHCYRCEDCGGLLSEGDNQGCYPLDGHILCKTCNSA
RIRVLTAKASTDL
Download sequence
Identical sequences A0A2K6E5M6
XP_005545491.1.63531 XP_005545492.1.63531 XP_011721449.1.29376 XP_011721450.1.29376 XP_015300423.1.63531 XP_015300424.1.63531 ENSMMUP00000022120 ENSMMUP00000022120 9544.ENSMMUP00000022120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]