SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022224 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022224
Domain Number 1 Region: 29-85
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000402
Family Ovomucoid domain III-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022224   Gene: ENSMMUG00000016907   Transcript: ENSMMUT00000023747
Sequence length 85
Comment pep:known chromosome:MMUL_1:6:144857717:144861207:1 gene:ENSMMUG00000016907 transcript:ENSMMUT00000023747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIIGGLLLLCTVFYFCSSSEAASLSSKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITY
GNECHLCTESLKSNGRVQFLHDGSC
Download sequence
Identical sequences F7CPW6 G7P8M3
XP_005558253.1.63531 ENSMMUP00000022224 ENSMMUP00000022224 9544.ENSMMUP00000022224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]