SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022339 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022339
Domain Number 1 Region: 473-509
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000943
Family Ovomucoid domain III-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022339   Gene: ENSMMUG00000016983   Transcript: ENSMMUT00000023866
Sequence length 543
Comment pep:known chromosome:MMUL_1:11:6806356:6815427:-1 gene:ENSMMUG00000016983 transcript:ENSMMUT00000023866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKPATGFLPSLLKVLLLPLAPAPAQDSTRASTPGSPLSPTEYEHFFALLTPTWKAETTC
RLRATHGCRNPTLVQLDQYENHGLVPDGAVCSNLPYASWFESFCQFTQYRCSNHIYYAKR
VLCSQPVSILSPNTLKEIDAPAELSPTTMTSPISPHFTGTERQAFQPWPERLSNNVEELL
QSSLSLGGQEQAPERRQEQGVEHRQEPMQEHKQEEGREQEEQEEEQEEEGKQEEGQGTKE
GLEAVSQLQTDSEPKFHSESLSSNPSSFTPRVREVESTPMMMENIQELIRSAQQMDEMNE
IYDENSYWRNQNPGSLLQLPHTEALLVLCYSIVENTCIITPTAKAWKYMEEEILGFGKSV
CDSLGRRHLSTCALCDFCSLKLEQCHSEASLQRQQCDTSHKTPFVSPLLASQSLSIGNQV
GSPESGHFYGLDLYGGLRMDFWCARLATKGCEDVRVSGWLQTEFLSFQDGDFPTKICDTD
YIQYPNYCSFKSQQCLMRNRNRKVSRMRCLQNETYSVLSPGKSEEVVLRWSQEFSTLTLG
QFG
Download sequence
Identical sequences A0A2K5UCT2 F7AZP4
ENSMMUP00000022339 ENSMMUP00000022339 XP_001107683.1.72884 XP_005569984.1.63531 9544.ENSMMUP00000022339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]