SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022561 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022561
Domain Number 1 Region: 1876-1950
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-38
Family Classic zinc finger, C2H2 0.0000228
Further Details:      
 
Domain Number 2 Region: 2054-2104
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000533
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 2302-2350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000182
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000022561
Domain Number - Region: 539-605
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000262
Family beta-sandwich domain of Sec23/24 0.019
Further Details:      
 
Domain Number - Region: 2009-2062
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000783
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number - Region: 2410-2438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00149
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number - Region: 2194-2241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00272
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number - Region: 1470-1495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00318
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number - Region: 105-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00579
Family Classic zinc finger, C2H2 0.049
Further Details:      
 
Domain Number - Region: 439-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0168
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 1116-1139,1262-1287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0354
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Domain Number - Region: 843-871
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0358
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number - Region: 885-916
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0405
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Domain Number - Region: 600-625
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0434
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number - Region: 1662-1687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0795
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 162-187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0809
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022561   Gene: ENSMMUG00000017151   Transcript: ENSMMUT00000024113
Sequence length 2508
Comment pep:known chromosome:MMUL_1:15:29187563:29337917:-1 gene:ENSMMUG00000017151 transcript:ENSMMUT00000024113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVLQCDGCDFRAPSYEDLKAHIQDVHTAFLQPTDVAEDNVNEPRCGSMNASNQTEVEFS
SIKDEFAIAEDLSGQNATALGTGGYYGHSPGYYGHHIAANPKPTNKFFQCKFCVRYFRSK
NLLIEHTRKVHGAQAEGSSSGPPVPGSLNYNIMMHEGFGKVFSCQFCTYKSPRRARIIKH
QKMYHKNNLKETTAPPPAPAPMPDPVVPPVSLQDPCKELPAEVVERSILESMVKPLTKSR
GNFCCEWCSYQTPRRERWCDHMMKKHRSMVKILSSLRQQQEGTNLPDVPNKSAPSPTSNS
TYLTMNAASREIPNTTVSNFRGSMGNSIMRPNSSSASKFSPMSYPQMKPKSPHNSGLVNL
AERSRYGMTDMTNSSADLETNSMLNDSSSDEELNEIDSENGLSVMDHQTSGLSAEQLMGS
DGNKLLETKGIPFRRFMNRFQCPFCPFLTMHRRSISRHIENIHLSGKTAVYKCDECPFTC
KSSLKLGAHKQCHTGTTSDWDAVNSQSESISSSLNEGMVSYESSSINGRKSGVMLDPLQQ
QQPPQPPPPPPPPPPSQPQPLQQPQPPQLQPPHQVPSQPQTQPPPTQQPQPPTQAAPLHP
YKCTMCNYSTTTLKGLRVHQQHKHSFCDNLPKFEGQPSSLPLENETDSHPSSSNTVKKSQ
TSILGLSSKNNFVAKASRKLANDFPLDLSPVKKRTRIDEIASNLQSKINQTKQQEDAVIN
VEDDEEEEEDNEVEIEVELDREEEPTEPIIEVPTSFSAQQIWARDTSEPQKEPNFRNITH
DYNATNGAEIELTLSEDEEDYYGSSTNLKDHQVSNTALLNTQTPIYGTEHNNENTDFGDS
GRLYYCKHCDFNNKSARSVSTHYQRMHPYIKFSFRYILDPNDHSAVYRCLECYIDYTNFE
DLQQHYGEHHPEAMNVLNFDHSDLIYRCRFCSYTSPNVRSLMPHYQRMHPTVKNHNAMIF
SSYVVEQQEGLNTESQTLREILNSAPKNMATSTPVARGGGLPATFNKNTPSKTFTPECEN
QKDPLVNTVVVYDCDVCSFASPNMHSVLVHYQKKHPEEKASYFRIQKTMRMVSVDRGSAL
SQLSFEVGAPMSPKMSNMGSPPPPQPPPPDLSTELYYCKHCSYSNRSVVGVLVHYQKRHP
EIKVTAKYIRQAPPTAAMMRGVEGPQGSPRPPAPMQQLNRSSSERDGPPVENEMFFCQHC
DYGNRTVKGVLIHYQKKHRDFKANADVIRQHTATIRSLCDRNQKKPASCVLVSASNLERD
KTKLRALKCRQCSYTSPYFYALRKHIKKDHPALKATVTSIMRWAFLDGLIEAGYHCEWCI
YSHTEPNGLLLHYQRRHPEHYVDYTYMATKLWAGPDPSPPSLTMPAEAKTYRCRDCVFEA
VSIWDITNHYQAFHPWAMNGDESVLLDIIKEKDAVEKPILSSEELAGPVNCENSIPTPLP
EQEAECPEDARLSPEKSLQLASANPAISSTPYQCTVCQSEYNNLHGLLTHYGKKHPGMKV
KAADFAQDIDINPGAVYKCRHCPYINTRIHGVLTHYQKRHPSIKVTAEDFVHDVEQSADI
SQNDVEETSRIFKQGYGAYRCKLCPYTHGTLEKLKIHYEKYHNQPEFDVFSQSPPKLPVP
LEPEMTTEVSPSQVSITEEEVGEEPVSTSHFSTSHLVSHTVFRCQLCKYFCSTRKGIARH
YRIKHNNVRAQPEGKNNLFKCALCAYTNPIRKGLAAHYQKRHDIDAYYTHCLAASRTISD
KPNKVIIPSPPKDDSPQLSEELRRAVEKKKCSLCSFQSFSKKGIVSHYMKRHPGVFPKKQ
HASKLGGYFTAVYADEHEKPTLMEEEERSSFEKAEVEGEAQEIEWLPFRCIKCFKLSFST
AELLCMHYTDHHSRDLKRDFIILGNGPRLQNSTYQCKHCDSKLQSTAELTSHLNIHNEEF
QKRAKRQERRKQLLSKQKYADGAFADFKQERPFGHLEEVPKIKERKVVGYKCKFCVEVHP
TLRAICNHLRKHVQYGNVPAVSAAVKGLRSHERSHLALAMFTREDKYSCQYCSFVSAFRH
NLDRHMQTHHGHHKPFRCKLCSFKSSYNSRLKTHILKAHAGEHAYKCSWCSFSTMTISQL
KEHSLKVHGKALTLPRPRIVSLLSSHSHHSSQKATPAEEVEDSNDSSYSEPPDVQQQLNH
YQSAALARNNSRVSPVPLSGAAAGTEQKTEAVLHCEFCEFSSGYIQSIRRHYRDKHGGKK
LFKCKDCSFYTGFKSAFTMHVEAGHSAVPEEGPKDLRCPLCLYHTKYKRNMIDHIVLHRE
ERVVPIEVCRSKLSKYLQGVVFRCDKCTFTCSSDESLQQHIEKHNELKPYKCQLCYYETK
HTEELDSHLRDEHKVSRNFELVGRVNLDQLEQMKEKMESSSSDDEDKEDEMNSKTEDREL
MRFSDHGAAINTEKRFPCEFCGRAFSQGSEWERHVLRHGMALNDTKQVSREEIHPKEIME
NSVKMPSIEEKEDDEAIGIDFSLKNETVAICVVTADKSLLENAEAKKE
Download sequence
Identical sequences ENSMMUP00000022561 ENSMMUP00000022561 9544.ENSMMUP00000022561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]