SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022636 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022636
Domain Number 1 Region: 481-820
Classification Level Classification E-value
Superfamily Folate-binding domain 1.19e-87
Family Aminomethyltransferase folate-binding domain 0.0000178
Further Details:      
 
Domain Number 2 Region: 67-288,388-473
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.94e-57
Family FAD-linked reductases, N-terminal domain 0.0000651
Further Details:      
 
Domain Number 3 Region: 288-387
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.77e-28
Family L-aminoacid/polyamine oxidase 0.0074
Further Details:      
 
Domain Number 4 Region: 822-916
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.00000000000000589
Family Aminomethyltransferase beta-barrel domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022636   Gene: ENSMMUG00000017210   Transcript: ENSMMUT00000024191
Sequence length 918
Comment pep:known chromosome:MMUL_1:15:4796509:4875997:1 gene:ENSMMUG00000017210 transcript:ENSMMUT00000024191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLSRALRVAAACPRQSPTRGLGPCNLSSASGPTAEKSVPYQRTLKEGQGTSVVAQGPS
RPLPSTANVVVIGGGSLGCQTLYHLAKLGMSGAVLLERERLTSGTTWHTAGLLWQLRPSD
VEVELLAHTRRVVSRELEEETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGVESH
VLSPAETKTLYPLMNVDDLYGTLYVPHDGTMDPAGTCSTLARAASARGAQVIENCPVTGI
RVWTDDFGVRRVAGVETPHGSIQTPCVVNCAGVWASAVGRMAGVKVPLVAMHHAYVVTER
IEGIQNMPNVRDHDASVYLRLQGDALSVGGYEANPIFWEEVSDKFAFGLFDLDWEVFTQH
IEGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGGC
GQELAHWIIHGRPDKDMHGYDIRRFHHSLTDHPRWIRERSHESYAKNYSVVFPHDEPLAG
RNMRRDPLHEELLGQGCVFQERHGWERPGWFHPQGPAPVLEYDYYGAYGSRPHEDYAYRR
LLADEYTFDFPPHHDTIKKECLACRGAAAVFDMSYFGKFYLVGLDARKAADWLFSADVSR
PPGSTVYTCMLNHRGGTESDLTVSRLAPSHQASPLAPAFEGDGYYLAVGGAVAQHNWSHI
TTVLQDQKFQCQLIDSSEDLGMVSIQGPASRAILQEVLDADLSNEAFPFSTHKLLRAAGH
LVRAMRLSFVGELGWELHIPKASCVPVYRAVMAAGAKHGLVNAGYRAIDSLSIEKGYRHW
HADLRPDDSPLEAGLAFTCKLKSPVPFLGREALEQQRAAGLRRRLVCFTVEDKVPMFGLE
AIWRNGQVVGHVRRADFGFAIDKTIAYGYIHDPSGGPVSLDFVKSGDYALERMGVTYGAR
AHLKSPFDPDNKRVKGTY
Download sequence
Identical sequences 9544.ENSMMUP00000022636 ENSMMUP00000022636 XP_002799978.1.72884 ENSMMUP00000022636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]