SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022669 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022669
Domain Number 1 Region: 72-200
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.15e-46
Family Regulator of G-protein signaling, RGS 0.0000083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022669   Gene: ENSMMUG00000017237   Transcript: ENSMMUT00000024225
Sequence length 211
Comment pep:known chromosome:MMUL_1:1:177795007:177798265:-1 gene:ENSMMUG00000017237 transcript:ENSMMUT00000024225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSAMFLAVQHDCRPMDTSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKT
GKKSKQQAFIKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK
KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSL
MENNSYPRFLESEFYQDLCKKPQITTEPHAT
Download sequence
Identical sequences A0A096N0C5 A0A0D9RLP3 A0A2K5MUH8 A0A2K6C5Z9 A0A2K6L4Q4 A0A2K6N7N9 F7HBZ1 G7NXE1
ENSPANP00000005707 9544.ENSMMUP00000022669 ENSMMUP00000022669 ENSMMUP00000022669 NP_001252854.1.72884 XP_005540321.1.63531 XP_010373849.1.97406 XP_011744747.1.29376 XP_011927112.1.92194 XP_017747093.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]