SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022882 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022882
Domain Number 1 Region: 114-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000285
Family LIM domain 0.00077
Further Details:      
 
Domain Number 2 Region: 48-80
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000392
Family LIM domain 0.001
Further Details:      
 
Domain Number 3 Region: 83-113
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000485
Family LIM domain 0.0013
Further Details:      
 
Domain Number 4 Region: 18-48
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000211
Family LIM domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022882   Gene: ENSMMUG00000017383   Transcript: ENSMMUT00000024447
Sequence length 165
Comment pep:known chromosome:MMUL_1:1:90033174:90041394:1 gene:ENSMMUG00000017383 transcript:ENSMMUT00000024447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDI
GTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRN
RLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVN
Download sequence
Identical sequences G1MCM0 G3TJF7 G7MHU6 G7NTM1
ENSMMUP00000022882 ENSLAFP00000014859 10141.ENSCPOP00000010895 9544.ENSMMUP00000022882 ENSAMEP00000017098 ENSCPOP00000010895 ENSCPOP00000010895 ENSMMUP00000022882 ENSLAFP00000014859 ENSAMEP00000017098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]