SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023140 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023140
Domain Number 1 Region: 81-219
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.21e-34
Family Glutathione S-transferase (GST), C-terminal domain 0.000000352
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.87e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.0000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023140   Gene: ENSMMUG00000017137   Transcript: ENSMMUT00000024724
Sequence length 222
Comment pep:known chromosome:MMUL_1:4:52468103:52512418:-1 gene:ENSMMUG00000017137 transcript:ENSMMUT00000024724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKPKLHYLNTRGRMEPIRWLLAAAGVEFEEKFLESAEDLDKLRNDGYLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGIADLGEMILLLPFCQPEDKDAN
TALIKEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRQPPMNAKSLEESRKIFRF
Download sequence
Identical sequences ENSMMUP00000023140 ENSMMUP00000033536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]