SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023402 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023402
Domain Number 1 Region: 57-163
Classification Level Classification E-value
Superfamily Fibronectin type III 2.01e-28
Family Fibronectin type III 0.00000469
Further Details:      
 
Domain Number 2 Region: 152-246
Classification Level Classification E-value
Superfamily Fibronectin type III 8.41e-17
Family Fibronectin type III 0.000000872
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023402   Gene: ENSMMUG00000017795   Transcript: ENSMMUT00000025011
Sequence length 369
Comment pep:known chromosome:MMUL_1:X:70015801:70019957:-1 gene:ENSMMUG00000017795 transcript:ENSMMUT00000025011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKPSLPFRSLLVLQLPLLGVALNTTILTPNGNEDATTDFFLTSMPTDSLSVSTLPLPEV
QCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQEK
EIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLRKLSESQLELNWNNRFLN
HCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEW
SHPIHWGSNSSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLV
TEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGPSPCNQHSPYWAP
PCYTLKPET
Download sequence
Identical sequences Q38JL2
ENSMMUP00000023402 NP_001030606.1.72884 XP_014983123.1.72884 ENSMMUP00000023402 9544.ENSMMUP00000023402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]