SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023521 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023521
Domain Number 1 Region: 9-154
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.18e-52
Family Galectin (animal S-lectin) 0.00011
Further Details:      
 
Domain Number 2 Region: 220-307
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.19e-30
Family Galectin (animal S-lectin) 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023521   Gene: ENSMMUG00000017890   Transcript: ENSMMUT00000025142
Sequence length 308
Comment pep:known chromosome:MMUL_1:16:22812274:22828466:1 gene:ENSMMUG00000017890 transcript:ENSMMUT00000025142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFSCSQAPYLSPAIPFSGTIQGGLQDGLQITVNGTVLSSSGSRFAVNFQTGFSGNDIAF
HFNPRFEDGGYVVCNTRQNGSWGPEERKMHMPLQKGMPFDLCFLVQSSDFKVMVNGSLFV
QYFHRVPFHRVDTISVNGAVQLSYISFQNPRTVPVQPAFSMVPFSQPVCFPPRPRGRRQK
PPSVWPANPAPITQTVIHTKTSSPSVWQLPWLPLAALSPFFPQPMPFVTTIPGGLYPSKS
ITLSGTVLPSAQRFHINLCSGSHIAFHLNPRFDENAVVRNTQINNCWGSEERSLPRKMPF
VRGQSFSV
Download sequence
Identical sequences ENSMMUP00000023521 9544.ENSMMUP00000023521 ENSMMUP00000023521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]