SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023535 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023535
Domain Number 1 Region: 628-675
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 5.41e-17
Family Serine proteinase inhibitor lekti 0.0042
Further Details:      
 
Domain Number 2 Region: 770-817
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 6.52e-17
Family Serine proteinase inhibitor lekti 0.0061
Further Details:      
 
Domain Number 3 Region: 941-988
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 3.05e-16
Family Serine proteinase inhibitor lekti 0.014
Further Details:      
 
Domain Number 4 Region: 562-612
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 8.46e-16
Family Serine proteinase inhibitor lekti 0.0014
Further Details:      
 
Domain Number 5 Region: 222-270
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 9.01e-16
Family Serine proteinase inhibitor lekti 0.0071
Further Details:      
 
Domain Number 6 Region: 92-152
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000152
Family Ovomucoid domain III-like 0.017
Further Details:      
 
Domain Number 7 Region: 364-411
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000735
Family Serine proteinase inhibitor lekti 0.00021
Further Details:      
 
Domain Number 8 Region: 294-342
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000735
Family Serine proteinase inhibitor lekti 0.0013
Further Details:      
 
Domain Number 9 Region: 702-751
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000887
Family Serine proteinase inhibitor lekti 0.028
Further Details:      
 
Domain Number 10 Region: 492-540
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000998
Family Serine proteinase inhibitor lekti 0.0061
Further Details:      
 
Domain Number 11 Region: 158-205
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000105
Family Serine proteinase inhibitor lekti 0.0065
Further Details:      
 
Domain Number 12 Region: 433-480
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000118
Family Serine proteinase inhibitor lekti 0.001
Further Details:      
 
Domain Number 13 Region: 1021-1076
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000013
Family Ovomucoid domain III-like 0.015
Further Details:      
 
Domain Number 14 Region: 846-894
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000388
Family Serine proteinase inhibitor lekti 0.0046
Further Details:      
 
Domain Number 15 Region: 26-75
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000157
Family Serine proteinase inhibitor lekti 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023535   Gene: ENSMMUG00000017900   Transcript: ENSMMUT00000025157
Sequence length 1093
Comment pep:known chromosome:MMUL_1:6:144498664:144568762:1 gene:ENSMMUG00000017900 transcript:ENSMMUT00000025157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIATVSVLLPLALCLIQDAASENEDQEICHEFQAFMKNGKLFCPQDKKFFLSLDGIMFI
NKCATCKMILEKEAKSQKRVRHLARATKATAPTELNCDDFKKGERDGDFICPDFYEAVCG
TDGKTYGNRCELCAENAKTGSQIGVKSEGECKSSNPEQDVCSAFRPFVKDGRLGCTREND
PVLGPDGKTHGNKCAMCAELFLKETENAKRQGETRIRRNAEKDFCKEYEKQVRNGRLFCT
RESDPVRGPDGRMHGNKCALCAEIFKRRFSEENSKTDKNSGKAEGKTEVKREILKLCSEY
QNQAKNGILFCTRENDPIRGPDGKMHGNLCSMCQVYFQAENEEKKKAEAQARNKRESGKA
TSYAELCSEYRKLVRNGKLACTRENDPIQGPDGKVHGNTCSMCEVFFQAEEKEKKKKEGE
SRNKRESKSTASFEELCSEYRKSRNNGPLFCTRENDPIQGPDGKMHGNTCSMCEVFFQQE
ERAKAKAKREAAKEICSEFRDQVRNGTLTCTREHNPVRDPDGKMHGNKCAMCASVFKLEE
EEKKNNKEEKGKVEAEKVKREAVQELCSEYRHYVRNGRLPCTRENDPIEGLDGKIHGNTC
SMCEAFFQQEAKEKGAEPRAKVKREAEKETCDEFRSLLQNGKLFCTRENDPVRGPDGKTH
GNKCAMCKAVFQKEDEERKRKEEEDQRNAAGHGSSDGGGGNTQDKCAEFREQMKNGRLSC
TRESDPVRDADGKSYNNKCTMCKAKLEREAERKNDDSHSSSNGTGSESGKDTCDEFRNQM
KNGKLICTRESDPVRGPDGKTHGNKCAMCKEKLEKEAAEKKKKEDENRSNTGERSNDKES
DSDAIDLCREFRSMRINGKLICTRENNPVRGPYGKMHINKCAMCQSIFDREANERKKKDE
EKSSSKPSNNAKDQCRQVQNEAEDAKFRQPVCSLASVARISTDECSEFRNYIRNNELICP
RENDPVRGADGKFYTNKCYMCRAVFLTEALERAKLQEKPSHVRASQEQDSPDSLSSLDSE
MCKDYRVLPRIGYLCPKDLKPVCGDDGQTYNNPCMLCHENLIRQTNTHIRSTGKCEESST
PETTAASKPSSVS
Download sequence
Identical sequences 9544.ENSMMUP00000033906 ENSMMUP00000023535 ENSMMUP00000033906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]