SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023577 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023577
Domain Number 1 Region: 1464-1764
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.14e-63
Family Protein kinases, catalytic subunit 0.00000268
Further Details:      
 
Domain Number 2 Region: 2723-2958
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-60
Family Protein kinases, catalytic subunit 0.0000232
Further Details:      
 
Domain Number 3 Region: 933-1027
Classification Level Classification E-value
Superfamily Immunoglobulin 4.16e-23
Family I set domains 0.00081
Further Details:      
 
Domain Number 4 Region: 1152-1255,2540-2636
Classification Level Classification E-value
Superfamily Fibronectin type III 6.56e-22
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 5 Region: 738-831
Classification Level Classification E-value
Superfamily Immunoglobulin 7.34e-22
Family I set domains 0.006
Further Details:      
 
Domain Number 6 Region: 590-683
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-21
Family I set domains 0.015
Further Details:      
 
Domain Number 7 Region: 2453-2545
Classification Level Classification E-value
Superfamily Immunoglobulin 3.9e-19
Family I set domains 0.015
Further Details:      
 
Domain Number 8 Region: 1059-1151
Classification Level Classification E-value
Superfamily Immunoglobulin 1.23e-18
Family I set domains 0.024
Further Details:      
 
Domain Number 9 Region: 842-930
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000413
Family I set domains 0.0072
Further Details:      
 
Domain Number 10 Region: 1260-1357
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000413
Family I set domains 0.057
Further Details:      
 
Domain Number 11 Region: 1349-1394
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000244
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023577   Gene: ENSMMUG00000017936   Transcript: ENSMMUT00000025201
Sequence length 2973
Comment pep:known chromosome:MMUL_1:12:83292805:83342412:1 gene:ENSMMUG00000017936 transcript:ENSMMUT00000025201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSETAEDDISDVQGTQRLELRDDGAFSTPTGGSDTLVGTSLDTPPTSVTGTSEEQVSWWG
SGQTVLEQEAGSGGGTRRLPGSPRQAQATGAGPRHLGVEPLVRASRANLVGASWGSEDSL
SVASDLYGSAFSLYRGRALSIHVSVPQSGLRREEPDLQPQLASEAPRRPAQPPPSKSALL
PPPSPRVGKRSPPGPQAQPTATPTSPHRRTQELVLPEDTTTEEKRGKKSKSSGPSLAGTA
ESRPQTPLSEASGRLSALGRSPRLVRAGSRILDKLQFFEERRRSLERSDSPPAPLRPWVP
LRKARSLEQPKSERGAPWGTPGASQEELRAPGSVAERRRLFQQKAASLDERTRQRSPASD
LELRFAQELGRIRRSTSREELVRSHESLRATLQRAPSPREPGEPPLFSRPSTPKTSRAVS
PAAAQPPPPSSAGKPGDEPGRPRSRGPAGRTEPGEGPQQEVRRRDQFPLTRSRAIQECRS
PVPPPAADPPEARTKAPPGRKREPPAQAVRFLPWATPGLEGAAVPQTLEKNRAGPEAEKR
LRRGPEEDGPWGPWDRRGARSQGKGRRARPTSPELESSDDSYVSAGEEPLEAPMFEIPLQ
NVVVAPGADVLLKCIVTANPPPQVSWHKDGSALRSEGRLLLRAEGERHTLLLREARAADA
GSYMATAINELGQATCAASLTVRPGGSASPFSSPITSDEEYLSPPEEFPEPGETWPRTPT
MKTSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPV
RPDQRRFAEEAEGGLCQLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRAHPESRSLA
VLAPLQDVDVGAGEMALFECLVAGPTDVEVDWLCRGRLLQPALLKCKMHFDGRKCKLLLT
SVHEDDSGVYTCKLSTAKDELTCSARLTVRPSLAPLFTRLLEDVEVLEGRAARFDCKISG
TPPPVVTWTHFGRPMEESENLRLRQDGGLHSLHIAHVGSEDEGLYAVSAVNTHGQAHCSA
QLYVEEPRTAASGPSSKLEKMPSIPEEPEQGELERLSIPDFLRPLQDLEVGLAKEAMLEC
QVTGLPYPTISWFHNGHRIQSSDDRRMTQYRDVHRLVFPAVGPQHAGVYKSVIANKLGKA
ACYAHLYVTDVVPGPPDGAPQVVAVTGRMVTLTWNPPRSLDMAIDPDSLTYTVQHQVLGS
DQWTALVTGLREPGWAATGLRKGVQHIFRVLSTTVKSSSKPSPPSEPVQLLEHGPPLEEA
PAVLDKPDIVYVVEGQPASVTVTFNHVEAQVVWRSCRGALLEARAGVYELSQPDDDQYCL
RICRVSRRDMGALTCTARNRHGTQTCSVTLELAEAPRFESIMEDVEVGAGETARFAVVVE
GKPLPDIMWYKEGGARAEAAHLLESDVTPPPCSAQEAASPGLPATTPPAQPSTLSPQHSC
TSSVSFLSQTAMEVEGVGEDEDHRGRRLSDFYDIHQEIGRGAFSYLRRVVERSSGLEFAA
KFIPSQAKPKASARREARLLARLQHDCVLYFHEAFERRRGLVIVTELCTEELLERMARKP
TVCESEIRAYMRQVLEGIHYLHQSHVLHLDVKPENLLVWDGAEGEEQVRICDFGNAQELT
PGEPQYCQYGTPEFVAPEIVNQSPVSGVTDIWPVGVVAFLCLTGISPFVGENDRTTLMNI
RNYNVAFEETTFLSLSREARGFLIKVLVQDRLRPTAEETLEHPWFKTQAKGAEMSTDHLK
LFLSRRRWQRSQISYKCHLVLRPIPELLRAPPERVWVTMPRRPPPSGGLSSSSDSEEEEL
EELPSVPRPLQPEFSGSRVSLTDIPTEDEALGTPETGAATPMDWQEQGRAPSQDQEAPSP
EALPSLGQEPAAGASPKRGELRRGSSAESALPRAGPREPGRGLQKAASVELPQRRSPSPG
ATRLARGGLGEGEYAQRLQALRQRLLRGGPEDGKVSGLRGPLLESLGGRARDPRMARAAS
SEAAPHHQPPLENRGLQKSSSFSQGEAEPRGRHRRAGAPLEIPVARLGARRLQESPSLSA
LSEAQPSSPARPSVPKPSALKSAEPSATTPSDAPQPPAPQPAQDKAPEPRPEPVRASKPA
PRPEALQTLALPLTPYAQIIQSLQLSGHAQGPPQGPAASPSELKPHAAVFARVASPPPGA
PEKRVPSAGAPPVLAEKARVPTVPPRPGSSLSSSIENLESEAVFEAKFKRSRESPLSRGL
RLLSRSRSEERGPFRGAEEEDGIYRPSPAGTPLELVRRPERSRSVQDLRAVGEPGLVRRL
SLSLSQRLRRTPPAQRHPAWEARGGDGESSEGGSSARGSPVLAMRRRLSSTLERLSSRLQ
RSGSSEDSGGASGRSTPLFGRLRRATSEGESLRRLGLPHNQLAAQAGATTPSAESLGSEA
SATSGSSAPGESRSRLRWGFSRQRKDKGLSQPNLSASIQEELGHQYVRSESDFPPVFHIK
LKDQVLLEGEAATLLCLPAACPAPHISWMKDKKSLRSEPSVIIVSCKDGRQLLSIPRVGK
RHAGLYECSATNVLGSITSSCTVAVARVPGKLAPPEVPQTYQDTALVLWKPGDSRAPCTY
TLERRVDGESVWHPVSSGIPDCYYNVSHLPVGMTVRFRVACANRAGQGPFSNPSEKVFVR
GTQGQCNGVAKLRLEKFWDLPGTEPVSGKAGTRSLVSRIELWSPHRNCCILAPRGPCSPP
LAFTVSVPLPSSEPVVTLPPTHRGRFGVVRACRENATGRTFVAKIVPYAAEGKRRVLQEY
EVLRTLHHERIMSLHEAYITPRYLVLIAESCGNRELLCGLSDRFRYSEDDVATYVAQLLQ
GLDYLHGRHVLHLDIKPDNLLLAPDNALKIVDFGSAQPYNPQALRPLGHRTGTLEFMAPE
MVKGEPIGSATDIWGAGVLTYIMLSGRSPFYEPDPQETEARIVGGRFDAFQLYPNTSQSA
TLFLRKVLSVHPCGRPPSSCLSVCHKEIKMASS
Download sequence
Identical sequences ENSMMUP00000023577 ENSMMUP00000023577 9544.ENSMMUP00000023577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]