SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023999 from Macaca mulatta 69_1

(show help)
Strong hits

Sequence:	ENSMMUP00000023999
Domain Number 1	Region: 89-131
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	2.85e-16
Family	LIM domain	0.0024
Further Details:

Domain Number 2	Region: 132-177
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	4.5e-16
Family	LIM domain	0.00037
Further Details:

Domain Number 3	Region: 8-35
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000013
Family	LIM domain	0.0024
Further Details:

Weak hits

Sequence:	ENSMMUP00000023999
Domain Number -	Region: 35-59
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0936
Family	LIM domain	0.012
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

External link(s)	Protein: ENSMMUP00000023999 Gene: ENSMMUG00000018257 Transcript: ENSMMUT00000025654
Sequence length	180
Comment	pep:known chromosome:MMUL_1:11:73856567:73864480:-1 gene:ENSMMUG00000018257 transcript:ENSMMUT00000025654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTIGSSIPEFHCSC LVYLKGPCGNSCLLSFPLSTSVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKII GAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ
Download sequence
Identical sequences	ENSMMUP00000023999 9544.ENSMMUP00000023999 ENSMMUP00000023999

SEARCH