SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024067 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024067
Domain Number 1 Region: 45-182
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-41
Family Galectin (animal S-lectin) 0.00023
Further Details:      
 
Domain Number 2 Region: 209-335
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.59e-16
Family Galectin (animal S-lectin) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024067   Gene: ENSMMUG00000018304   Transcript: ENSMMUT00000025726
Sequence length 336
Comment pep:known chromosome:MMUL_1:14:10950101:10960722:-1 gene:ENSMMUG00000018304 transcript:ENSMMUT00000025726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSQPSGGRAPGTRIYSWSCPTLMSPGEKLDPIPDSFILQPPVFHPVVPYVTTIFGGLHAG
KMVMLQGVVPLDAHRFQVDFQCGCSLCPRPDIAFHFNPRFHTTKPHVICNTLHGGRWQRE
ARWPHLALQKGSSFLILFLFGNEEVKVSVNGQHFLHFRYRLPLSHVDTLGIFGDILVEAV
GFLNINPFVEGSREYPAGHPFLLMSPRLEVPCSHALPQGLWPGQVIIVRALVLQEPKHFT
LSLRDQASRAPVTLRASFTDRTLAWISPWGQKKLISAPFLFYPQRFFEVLLLCQEGGLKL
ALNGQGLGATSVNQQALEQLRELRISGSVRLYCVHS
Download sequence
Identical sequences ENSMMUP00000024067 ENSMMUP00000024067 9544.ENSMMUP00000024067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]