SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024369 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024369
Domain Number 1 Region: 93-188
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.13e-28
Family Glutathione S-transferase (GST), C-terminal domain 0.00000492
Further Details:      
 
Domain Number 2 Region: 2-53
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000885
Family Glutathione S-transferase (GST), N-terminal domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024369   Gene: ENSMMUG00000018524   Transcript: ENSMMUT00000026042
Sequence length 192
Comment pep:known chromosome:MMUL_1:14:6863751:6866203:-1 gene:ENSMMUG00000018524 transcript:ENSMMUT00000026042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPPYTVVYFPVRGRCAALRMLLAEQGQSWKEEVVTMETWQEGSLKASCMNWQLKWTGFAS
RGDSETLVSGLGQTGVSGAGRDESRRMIHGGVWQEAGKDDYVKALPGQLKPFETLLSQNQ
GGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVARLSARPKLKAFLASPE
HVNLPINGNGKQ
Download sequence
Identical sequences ENSMMUP00000024369 9544.ENSMMUP00000024369 ENSMMUP00000024369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]