SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024423 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024423
Domain Number 1 Region: 863-1136
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-68
Family Protein kinases, catalytic subunit 0.00000797
Further Details:      
 
Domain Number 2 Region: 553-839
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.29e-48
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 3 Region: 409-534
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-16
Family SH2 domain 0.0022
Further Details:      
 
Domain Number 4 Region: 135-268
Classification Level Classification E-value
Superfamily Second domain of FERM 7.11e-16
Family Second domain of FERM 0.0039
Further Details:      
 
Domain Number 5 Region: 353-413
Classification Level Classification E-value
Superfamily PH domain-like 0.00000107
Family Third domain of FERM 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024423   Gene: ENSMMUG00000018566   Transcript: ENSMMUT00000026100
Sequence length 1144
Comment pep:known chromosome:MMUL_1:1:67606819:67657126:-1 gene:ENSMMUG00000018566 transcript:ENSMMUT00000026100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFCAKMRSSKKTEVNLEVPEPGVEVIFYMSDREPLRLGSGEYTAEELCIRAAQACRISP
LCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTNDNEQSVWRHSPK
KQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQDGHDIENECLGM
AVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRINNVFKDFLKEFN
NKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMNWFHSNDSGNVLY
YEVMVTGNLGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIREEWNNFSYFPEI
THIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAHHYLCTDVAPPLI
VHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVTCFEKSEQGQGAQ
KQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFMLKRCCQPKPREIS
NLLVATKKAQEWQPVYPMSQLSFDRIFKKDLVQGEHLGRGTRTHIYSGTLMDYKDDEGTS
EEKKIKVILKVLDPSHRDISLASAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFV
EGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSE
CGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNG
EIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEE
QNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSL
KPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPK
NKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIET
DKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLK
MIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFE
ALLK
Download sequence
Identical sequences G7MHH7 G7NW22
9544.ENSMMUP00000024423 ENSMMUP00000024423 ENSMMUP00000024423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]