SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024453 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024453
Domain Number 1 Region: 3-260
Classification Level Classification E-value
Superfamily Kelch motif 4.58e-58
Family Kelch motif 0.00018
Further Details:      
 
Domain Number 2 Region: 243-343
Classification Level Classification E-value
Superfamily Kelch motif 2.09e-17
Family Kelch motif 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024453   Gene: ENSMMUG00000018585   Transcript: ENSMMUT00000026130
Sequence length 352
Comment pep:known chromosome:MMUL_1:1:165069219:165076077:1 gene:ENSMMUG00000018585 transcript:ENSMMUT00000026130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVPNVKDFQWKRLAPLPSRRVYCSLLETGGQVYAIGGCDDNGVPMDCFEVYSPEADQWT
ALPPLPTARAGVAVTALGKRIMVIGGVGTNQLPLKVVEMYNIDEGKWKKRSMLREAAMGI
SVTAKGNNYRVYAAGGMGLDLRPHSHLQHYDMLKDMWVSLAPMPTPRYAATSFLRGSKIY
VLGGRQSKYAVNAFEVFDIETRSWTKFPNIPCKRAFSSFVTLDSHLYSLGGLRQGRLYRQ
PKFLRTMDVFDMEQGGWLKMERSFFLKKRRADFVAGSLSGRVIVAGGLGNQPTVLETAEA
FHPGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQGLSDAVEALCVSDS
Download sequence
Identical sequences ENSMMUP00000024453 9544.ENSMMUP00000024453 ENSMMUP00000024453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]