SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024716 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024716
Domain Number 1 Region: 4-137
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.15e-29
Family RPR domain (SMART 00582 ) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024716   Gene: ENSMMUG00000018777   Transcript: ENSMMUT00000026402
Sequence length 312
Comment pep:known chromosome:MMUL_1:18:28955189:29028914:-1 gene:ENSMMUG00000018777 transcript:ENSMMUT00000026402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKAKPNRKLTFL
YLANDVIQNSKRKGPEFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYEND
VLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLVRALQDLENAASGD
AAVHQRIASLPVEVQEVSLLDKITDKESGERLSKMVEDACMLLADYNGRLAAEIDDRKQL
TRMLADFLRCQKEALAEKEHKLEEYKRKLARVSLVRKELRSRIQNLPDLSRLPNVTGSHM
HLPFAGDIYSED
Download sequence
Identical sequences A0A0D9RZ94 A0A2I3LMG3 A0A2K5HRX2 A0A2K5TPT2 A0A2K5YT07 A0A2K6C5H9 A0A2K6KDX0 A0A2K6QX95 F6ZWD4
ENSMMUP00000024716 9544.ENSMMUP00000024716 NP_001247897.1.72884 XP_003784787.1.62490 XP_005586925.1.63531 XP_005586926.1.63531 XP_007972445.1.81039 XP_007972446.1.81039 XP_010361000.1.97406 XP_010361001.1.97406 XP_011769584.1.29376 XP_011769593.1.29376 XP_011799059.1.43180 XP_011829825.1.47321 XP_014977208.1.72884 XP_017729495.1.44346 XP_017729496.1.44346 ENSMMUP00000024716 ENSPANP00000006918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]