SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024896 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024896
Domain Number 1 Region: 3-128
Classification Level Classification E-value
Superfamily ENTH/VHS domain 7.98e-28
Family RPR domain (SMART 00582 ) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024896   Gene: ENSMMUG00000018924   Transcript: ENSMMUT00000026603
Sequence length 326
Comment pep:known chromosome:MMUL_1:10:26369496:26426931:-1 gene:ENSMMUG00000018924 transcript:ENSMMUT00000026603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSFSESALEKKLSELSNSQQSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFL
YLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGE
FIQQLKLSMEDSKSPPPKATEEKKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEEL
IKALQDLENAASGDATVRQKIASLPQEVQDVSLLEKITDKEAAERLSKTVDEACLLLAEY
NGRLAAELEDRRQLARMLVEYTQNQKDVLSEKEKKLEEYKQKLARVTQVRKELKSHIQSL
PDLSLLPNVTGGLAPLPSAGDLFSTD
Download sequence
Identical sequences A0A096NXG4 A0A0D9RMP8 A0A0M3KWF7 A0A0P6J6P9 A0A1S3ER20 A0A1U7TE76 A0A2K5DMF0 A0A2K5KCP8 A0A2K5MV19 A0A2K5QCV8 A0A2K6AGQ9 A0A2K6BPG1 A0A2K6GZX6 A0A2K6M1I7 A0A2K6PIG8 A0A2K6SXR2 A6QLW3 D2H111 E2RRZ8 F2Z5H3 F6SLS3 F6ZTV4 F7IJC6 G1PJP3 G1R386 G1SJR2 G3QNP7 G7PGE9 H0XRZ5 H2P1W0 H2QKB9 K9II98 L5K090 L5LU97 L8IJA4 Q9NQG5 W5QAP8
ENSOGAP00000018887 ENSECAP00000015816 ENSPTRP00000023147 ENSP00000362532 ENSECAP00000015816 ENSMMUP00000024896 ENSPPYP00000012277 ENSCAFP00000012989 ENSBTAP00000006703 ENSTSYP00000012933 ENSCJAP00000040040 ENSBTAP00000006703 ENSOPRP00000003980 ENSPTRP00000023147 ENSOPRP00000003980 ENSOCUP00000002992 ENSPPYP00000012277 ENSCJAP00000040040 NP_001094604.1.59421 NP_001094604.1.76553 NP_001229521.1.37143 NP_001248615.1.72884 NP_001306206.1.57651 NP_067038.1.87134 NP_067038.1.92137 XP_001502456.1.31192 XP_001925742.2.46622 XP_002710817.1.1745 XP_002747595.1.60252 XP_002915195.1.58354 XP_003253612.1.23891 XP_003787633.1.62490 XP_003805060.1.60992 XP_003936422.1.74449 XP_004014613.1.66739 XP_004062173.1.27298 XP_004272882.1.21590 XP_004393231.1.74151 XP_004630957.1.9945 XP_004687256.1.23501 XP_004867844.1.39548 XP_005392607.1.28644 XP_005569031.1.63531 XP_005896057.1.15283 XP_005983106.1.78601 XP_006051802.1.26621 XP_006102076.1.53796 XP_006188685.1.101512 XP_006202616.1.17985 XP_006764552.1.95426 XP_006921866.1.64745 XP_007193201.1.59432 XP_007447779.1.90284 XP_008016033.1.81039 XP_008054708.1.4292 XP_008515650.1.77740 XP_008696333.1.72690 XP_010353639.1.97406 XP_010638348.1.5607 XP_010827473.1.44457 XP_010959047.1.22495 XP_010973535.1.51371 XP_011364898.1.92234 XP_011764954.1.29376 XP_011784454.1.43180 XP_011830372.1.47321 XP_011908213.1.92194 XP_011970136.1.54773 XP_012310463.1.9421 XP_012518267.1.63892 XP_012610448.1.48125 XP_012866369.1.60039 XP_014702662.1.49734 XP_016074833.1.3490 XP_017367680.1.71028 XP_017508273.1.32401 XP_017714561.1.44346 XP_019480622.1.44202 XP_019799329.1.83887 XP_019799330.1.83887 XP_019799332.1.83887 XP_019799333.1.83887 XP_019799334.1.83887 XP_019799335.1.83887 XP_019799336.1.83887 XP_019827961.1.53367 XP_020028085.1.5219 XP_021544680.1.83697 XP_542990.3.84170 ENSP00000362532 ENSMMUP00000024896 ENSEEUP00000006044 ENSTSYP00000012933 ENSGGOP00000004166 ENSGGOP00000004166 ENSNLEP00000007658 ENSOARP00000019793 ENSOCUP00000002992 ENSCAFP00000012989 ENSP00000362532 ENSAMEP00000012894 ENSEEUP00000006044 ENSSSCP00000007820 ENSPANP00000017758 ENSMLUP00000010980 ENSMLUP00000010980 ENSNLEP00000007658 ENSPVAP00000000540 gi|11034845|ref|NP_067038.1| ENSAMEP00000012894 ENSSSCP00000007820 ENSPVAP00000000540 ENSOGAP00000018887 9544.ENSMMUP00000024896 9598.ENSPTRP00000023147 9600.ENSPPYP00000012277 9606.ENSP00000362532 9615.ENSCAFP00000012989 9796.ENSECAP00000015816 9823.ENSSSCP00000007820 9913.ENSBTAP00000006703 9986.ENSOCUP00000002992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]