SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025010 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025010
Domain Number 1 Region: 1219-1579
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 9.55e-123
Family Hect, E3 ligase catalytic domain 0.00000000972
Further Details:      
 
Domain Number 2 Region: 805-841
Classification Level Classification E-value
Superfamily WW domain 0.0000000000046
Family WW domain 0.0014
Further Details:      
 
Domain Number 3 Region: 192-290
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000062
Family Synaptotagmin-like (S variant) 0.065
Further Details:      
 
Domain Number 4 Region: 989-1031
Classification Level Classification E-value
Superfamily WW domain 0.000000000144
Family WW domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025010   Gene: ENSMMUG00000019015   Transcript: ENSMMUT00000026729
Sequence length 1585
Comment pep:known chromosome:MMUL_1:3:82698152:82949976:-1 gene:ENSMMUG00000019015 transcript:ENSMMUT00000026729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSRNSQSRRRCKEPLRYSYNPDQFHNMDLRGGPHDGVTIPRSTSDTDLVTSDSRSTL
MVSSSYYSIGHSQDLVIHWDIKEEVDAGDWIGMYLIDEVLSENFLDYKNRGVNGSHRGQI
IWKIDASSYFVEPETKICFKYYHGVSGALRATTPSVTVKNSAAPIFKSIGADETVQGQGS
RRLISFSLSDFQAMGLKKGMFFNPDPYLKISIQPGKHSIFPALPHHGQERRSKIIGNTVN
PIWQAEQFSFVSLPTDVLEIEVKDKFAKSRPIIKRFLGKLSMPVQRLLERHAIGDRVVSY
TLGRRLPTDHVSGQLQFRFEITSSIHPDDEEISLSTEPESAPIQDSPMNNLMESGSGEPR
SEAPESSEGWKPEQLGEGSVLDGPGNQSMELSRPAEEAAVITEAGDQGMVSVGPEGAGDL
LAQVQKDIQPAPSAEELAEQLDLGEEASALLLEDGEAPASTEEEPLEEEATTQSRAGREE
EKEQEEEEGDVSTLEQGEGRLQLRASVKRKSRPCSLPVSELETVIASACGDPETPRTHYI
RIHTLLHSMPSAQGGSAAEEEDGAEEESTLKDSSEKDGLSEVDTVAADPSALEEDREEPE
GATPGTAHPGHSGGHFSSLANGAAQDGDTHPSTGSESDSSPRQGGDHSCEGCDASCCSPS
CYSSSCYSTSCYSSSCYSASCYSPSCYNGNRFASHTRFSSVDSAKISESTVFSSQDDEEE
ENSAFESVPDSMQSPELDPESTNGAGPWQDELAAPSGHEERTPEGLESPVAGPSNRREGE
CPILHNSQPVSQLPSLRPEHHHYPTIDEPLPPNWEARIDSHGRVFYVDHVNRTTTWQRPT
AAATPDGMRRSGSIQQMEQLNRRYQNIQRTIATERSEEDSGSQSCEQAPAGGGGGGGSDS
EAESSQSSLDLRREGSLSPVNSQKITLLLQSPAVKFITNPEFFTVLHANYSAYRVFTSST
CLKHMILKVRRDARNFERYQHNRDLVNFINMFADTRLELPRGWEIKTDQQGKSFFVDHNS
RATTFIDPRIPLQNGRLPNHLTHRQHLQRLRSYSAGEASEVSRNRGASLLARPGHSLVAA
IRSQHQHESLPLAYNDKIVAFLRQPNIFEMLQERQPSLARNHTLREKIHYIRTEGNHGLE
KLSCDADLVILLSLFEEEIMSYVPLQAAFHPGYSFSPRCSPCSSPQNSPGLQRASARAPS
PYRRDFEAKLRNFYRKLEAKGFGQGPGKIKLIIRRDHLLEGTFNQVMAYSRKELQRNKLY
VTFVGEEGLDYSGPSREFFFLLSQELFNPYYGLFEYSANDTYTVQISPMSAFVENHLEWF
RFSGRILGLALIHQYLLDAFFTRPFYKALLRLPCDLSDLEYLDEEFHQSLQWMKDNNITD
ILDLTFTVNEEVFGQVTERELKSGGANTQVTEKNKKEYIERMVKWRVERGVVQQTEALVR
GFYEVVDSRLVSVFDARELELVIAGTAEIDLNDWRNNTEYRGGYHDGHLVIRWFWAAVER
FNNEQRLRLLQFVTGTSSVPYEGFAALRGSNGLRRFCIEKWGKITSLPRAHTCFNRLDLP
PYPSYSMLYEKLLTAVEETSTFGLE
Download sequence
Identical sequences ENSMMUP00000025010 ENSMMUP00000025010 9544.ENSMMUP00000025010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]