SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025116 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025116
Domain Number 1 Region: 121-440
Classification Level Classification E-value
Superfamily L domain-like 6.63e-59
Family Internalin LRR domain 0.0088
Further Details:      
 
Domain Number 2 Region: 685-780
Classification Level Classification E-value
Superfamily Immunoglobulin 2.97e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 598-694
Classification Level Classification E-value
Superfamily Immunoglobulin 3.23e-20
Family I set domains 0.0071
Further Details:      
 
Domain Number 4 Region: 493-602
Classification Level Classification E-value
Superfamily Immunoglobulin 2.97e-18
Family I set domains 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000025116
Domain Number - Region: 46-114
Classification Level Classification E-value
Superfamily L domain-like 0.0238
Family Ngr ectodomain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025116   Gene: ENSMMUG00000019098   Transcript: ENSMMUT00000026841
Sequence length 1061
Comment pep:known chromosome:MMUL_1:1:116063954:116121798:1 gene:ENSMMUG00000019098 transcript:ENSMMUT00000026841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPAPLGIPEEQLLGCRSGLLSRLLFLAQSALLLLPAAGAGLCPAPCSCRIPLLDCSRRK
LPAPSWRALSGLLPPDTAILDLSHNRLSNWNISLESQMLQEVKMNYNELTEIPYFGEPTS
NITLLSLVHNIIPEINAQALQFYPALQSLDLSSNIISEIKTSSFPHMQLKYLNLSNNRIT
TLEAGCFDNLSSSLLVVKLNRNRISMIPPKIFKLPHLQFLELKRNRIKIVEGLTFQGLDS
LRSLKMQRNGISKLKDGAFFGLNNMEELELEHNNLTRVNKGWLYGLRMLQQLYVSQNAIE
RISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSN
LQTLDLRNNEISWAIEDASEAFAGLTSLTKLVLQGNQIKSITKKAFIGLESLEHLDLNNN
AIMSIQENAFSQTHLKELVMGVTQVISKSTQFRQEEMARGNFKIPNTEKPRVELDSSSVV
SLNFNMPLYDFLKPQIRTHPETIIALRGMNVTLTCTAVSSSDSPMSTVWRKDSEILYDVD
IENFVRYRQQAGEALEYTSILHLFNVNFTDEGKYQCIVTNHFGSNYSQKAKLTVNEMPSF
LKTPMDLTIRTGAMARLECAAEGHPAPQISWQKDGGTDFPAARERRMHVMPEDDVFFIAN
VKIEDMGIYSCMAQNIAGGLSANASLTVLETPSFIRPLEDKTVTRGETAVLQCIAGGSPA
PRLNWTKDDGPLLVTERHFFAAANQLLIIVDAGLEDAGKYTCIMSNTLGTERGHIYLNVI
SSPNCDSSQSSIGHEDDGWTTVGIVIIVVVCCVVGTSLIWVIVIYHMRRKNEDYSITNTE
ELNLPADIPSYLSSQGTLSEPQEGYSNSEAGSHQQLMPPANGYIHKGTDGGTSTRVICSD
CYDNANIYSRTREYCPYTYISEEDVLDQTLSSLMVQMPKETYLAHLPQDTTALESLISSA
DGEPSAFPTNHERISEKKLPSTPMSGETLQRPVWNINRELGLPHPPFSQQPVHESPQLHQ
NEGLAGLEPDCSASSMSCHRLQDHGFDFSRTRNIQDGSEGT
Download sequence
Identical sequences ENSMMUP00000025116 ENSMMUP00000025116 9544.ENSMMUP00000025116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]