SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025243 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025243
Domain Number 1 Region: 263-323
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.55e-18
Family Erythroid transcription factor GATA-1 0.00043
Further Details:      
 
Domain Number 2 Region: 211-261
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.08e-16
Family Erythroid transcription factor GATA-1 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025243   Gene: ENSMMUG00000019208   Transcript: ENSMMUT00000026982
Sequence length 442
Comment pep:known chromosome:MMUL_1:8:8981200:9033540:-1 gene:ENSMMUG00000019208 transcript:ENSMMUT00000026982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASSPVYVPTPRVPSSVLGLSYLQGGGAG
SASGGAAGGSSGAAASGAGPGTQQGSPGWSQAGADGAAYTPPPVSPRFSFPGTTGSLAAA
AAAAAAREAAAYSSGGGAAGAGLAGREQYGRAGFASSYSSPYPAYMADVGASWAAAAAAS
AGPFDSPVLHSLPGRANPAARHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNA
CGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMK
LHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAGPAGSESLPPASGASSNSSSATTSSSEE
MRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSLHPVLSALKLSPQGYVSPVSQSPQT
SSKQDSWNSLVLADSHGDIITA
Download sequence
Identical sequences I2CWU8
XP_015000236.1.72884 9544.ENSMMUP00000025243 ENSMMUP00000025243 ENSMMUP00000025243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]