SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025280 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025280
Domain Number 1 Region: 46-299
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.47e-37
Family Crotonase-like 0.0000000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025280   Gene: ENSMMUG00000019237   Transcript: ENSMMUT00000027022
Sequence length 305
Comment pep:known chromosome:MMUL_1:20:2236455:2250633:-1 gene:ENSMMUG00000019237 transcript:ENSMMUT00000027022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAAAVRVPARVLLRAGARLPGVALGLTERVDGWGDGARRFGSQRVLVEPDAGAGVAVM
KLKNPPVNTLSLEFLTELVICLEKLENEKSFRGVVLTSSGPAQTIVGMEPCGGWGTSRAH
PWHPWTRPSGMWLGPTAPKSLRALSGLSLQGACPAGGCLMTLTCDYRVLADNPRYCIGLN
ETQLGIVAPFWFKDTLENVIGHRAAERALQLGLLFPPAEALQVGIVDQVVPEEQVQSTAL
SAIAQWMTIPDHARQLTKAMMRKATASRLITQRDADVQNFVSFISKDSIQKSLQLYLERL
KEKKG
Download sequence
Identical sequences ENSMMUP00000025280 9544.ENSMMUP00000025280 ENSMMUP00000025280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]