SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025321 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025321
Domain Number 1 Region: 127-318
Classification Level Classification E-value
Superfamily vWA-like 1.63e-60
Family Integrin A (or I) domain 0.0000699
Further Details:      
 
Domain Number 2 Region: 433-617
Classification Level Classification E-value
Superfamily vWA-like 1.36e-56
Family Integrin A (or I) domain 0.00017
Further Details:      
 
Domain Number 3 Region: 2274-2479
Classification Level Classification E-value
Superfamily vWA-like 1.16e-55
Family Integrin A (or I) domain 0.00023
Further Details:      
 
Domain Number 4 Region: 1175-1355
Classification Level Classification E-value
Superfamily vWA-like 8.6e-41
Family Integrin A (or I) domain 0.00049
Further Details:      
 
Domain Number 5 Region: 2496-2699
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-31
Family Laminin G-like module 0.047
Further Details:      
 
Domain Number 6 Region: 1915-2081
Classification Level Classification E-value
Superfamily Fibronectin type III 2.03e-23
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 7 Region: 1731-1901
Classification Level Classification E-value
Superfamily Fibronectin type III 1.61e-22
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 8 Region: 634-803
Classification Level Classification E-value
Superfamily Fibronectin type III 5.05e-22
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 9 Region: 1545-1704
Classification Level Classification E-value
Superfamily Fibronectin type III 1.58e-21
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 10 Region: 1364-1540
Classification Level Classification E-value
Superfamily Fibronectin type III 6.38e-21
Family Fibronectin type III 0.00067
Further Details:      
 
Domain Number 11 Region: 815-986
Classification Level Classification E-value
Superfamily Fibronectin type III 3.27e-20
Family Fibronectin type III 0.00063
Further Details:      
 
Domain Number 12 Region: 1002-1176
Classification Level Classification E-value
Superfamily Fibronectin type III 5.8e-19
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 13 Region: 2094-2179
Classification Level Classification E-value
Superfamily Fibronectin type III 1.22e-18
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 14 Region: 332-422
Classification Level Classification E-value
Superfamily Fibronectin type III 6.68e-18
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 15 Region: 26-108
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000388
Family Fibronectin type III 0.00085
Further Details:      
 
Domain Number 16 Region: 2184-2267
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000713
Family Fibronectin type III 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025321   Gene: ENSMMUG00000019261   Transcript: ENSMMUT00000027065
Sequence length 3040
Comment pep:known chromosome:MMUL_1:4:71220333:71238134:-1 gene:ENSMMUG00000019261 transcript:ENSMMUT00000027065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTRLPPVLAALGAALLLSSIEAEVDPPSDLNFKIIDENTVHMSWAKPVDPIVGYRITVD
PTTDGPTKEFTLAASTTETLLSELVPETEYVVTITSYDEVEESVPVIGQLTIQTGSSTKP
VEKKPGKTEIQKCSVSAWTDLIFLVDGSWSVGRNNFKYILDFIAALVSAFDIGEEKTRVG
VVQYSSDTRTEFNLNQYYQRDELLAAIKKIPYKGGNTMTGDAIDYLVKNTFTESAGARVG
FPKVAIIITDGKSQDEVEIPARELRNVGVEVFSLGIKAADAKELKQIASTPSLNHVFNVA
NFDAIVDIQNEIISQVCSGVDEQLGELVSGEEVVEPPSNLIAVEVSSKYVKLSWNPSASP
VTGYKVILTPMTAGSRQHALSVGPQTTTLSVRDLSADTEYQISVSAMKGMTSSEPISIME
KTQPMKVQVECSRGVDIKADIVFLVDGSYSIGIANFVKVRAFLEVLVKSFEISPNRVQIS
LVQYSRDPHTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIFVPSKGSRSN
VPKVMILITDGKSSDAFRDPAIKLRNSDVEIFAVGVKDAVRSELEAIASPPAETHVFTVE
DFDAFQRISFELTQSICLRIEQELAAIKKKAYVPPKDLSFSEVTSYGFKTNWSPAGENVF
SYHITYKEATGDDEVTVVEPASSTSVVLSNLKPETLYLVNVTAEYEDGFSIPLAGEETTE
EVKGAPRNLKVTDETTDSFKITWTQAPGRVLRYRIIYRPVAGGESREVTTPPNQRRRTLE
NLIPDTKYEVTVIPEYFSGPGSPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGK
VKQYLVTYTPVAGGETQEVTVRGDTTNTVLRGLKEGTQYALSVTALYASGAGDALFGEGT
TLEERGSPRDLVTKDITDTSIGAYWTSAPGMVRGYRVSWKSLYDDVDTGEKNLPEDAIHT
MIENLQPETKYRISIFATYSSGEGEPLTGDATTELSQDSKTLKVDEETESTMRVTWKPAP
GKVVNYRVVYRPHGGGRQMVAKVPPTVTSTVLKRLQPQTTYDITVLPIYKTGEGKLRQGS
GTTASRFKSPRNLKTSDPTMSSFRVTWEPAPGEVKGYKVTFHPTGDDRRLGELVVGPYDN
TVVLEELRAGTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPILSSGMECLTRAEADI
VLLVDGSWSIGRANFRTVRSFISRIVEVFDIGPKRVQIALAQYSGDPRTEGQLNAHRDKK
SXXXXXXXTQAGMRPRARKIGVLITDGKSQDDVEAPSKKLKDEGVELFAIGIKNADEVEL
KMIATDPDDTHAYNVADFESLSRIVDDLTINLCNSVKGPGDLEAPSNLVISERTHRSFRV
SWTPPSDSVDRYKVEYYPVSGGKRQEFYVSRMETSTVLKDLKPETEYVVNVYSVVEDEYS
EPLKGTEKTLPVPVVSLNIYDVGPTTMHVQWQPVGGATGYILSYKPVKDTEPTTPKEMRL
GPTVNDMQLTDLVPNTEYAVTVQAVLHDLTSEPVTVREVTLPLPRPQDLKLRDVTHSTMN
VFWEPVPGKVRKYIVRYKTPEEDVKEVEVDRSETSTSLKDLFSQTLYTVSVSAVHDEGES
PPVTAQETTRPVPAPTNLRITEVTSEGFRGTWDHGASDVSLYRITWAPFGSSDKMETILN
GDENTLMFENLNPNTVYEVSITAIYPDESESDDLIGSERTLPILTTQAPKSGPRNLQVYN
ATSNSLTVKWDPASGRVQKYRITYQPSTGEGNEQTTTIGGRQNSVVLQKLKPDTPYTITV
SSLYPDGEGGQMTGRGKTKPLNTVRNLRVYDPSTSTLNVRWDHAEGNPRQYKLFYAPAAD
GPEELVPIPGNTNYAILRNLQPDTSYTVTVVPVYTEGDGGRTSDTGRTLMRGLARNVQVY
NPTPNSLDVRWDPAPGPVLQYRVVYSPVDGTRPSESIVVPGNTRMVHLERLIPDTLYSVN
LVALYSDGEGNPSPAQGRTLPRSGPRNLRVFGETTNSLSVAWDHADGPVQQYRIIYSPTV
GDPIDEYTTVPGRRNNVILQPLQPDTPYKITVIAVYEDGDGGHLTGNGRTVGLLPPQNIH
ISDEWYTRFRVSWDPSPSPVLGYKIVYKPVGSNEPMEAFVGEMTSYTLHNLNPSTTYDVN
VYAQYDSGLSVPLTDQGTTLYLNVTDLKTHQIGWDTFCVKWSAHRAATSYRLKLSPADGT
RGQEITVRGSETSHCFTGLSPDTDYGVTVFVQTPNLEGPGVSVKEHTTVKPTEAPTEPPT
PPPPPTIPPARDVCKGAKADIVFLTDASWSIGDDNFNKVVKFVFNTVGGFDEISPAGIQV
SFVQYSDEVKSEFKLNTYNDKALALGALQNIRYRGGNTRTGKALTFIKEKILTWESGMRK
NVPKVLVVVTDGRSQDEVKKVALVIQHSWFSVFVVGVADVDYNELANIASKPSERHVFIV
DDFESFEKIEDNLITFVCETATSSCPLIYLDGYTSPGFKMLEAYNLTEKNFASVQGVSLE
SGSFPSYSAYRIQKNAFVNQPTADLHPNGLPPSYTIILLFRLLPETPSDPFAIWQITDRD
YKPQVGVIADPSSKTLSFFNKDIRGEVQTVTFDTDEVKTLFYGSFHKVHIVVTPKSVKTY
IDCYEIIEKDIKEAGNITTDGYEILGKLLKGERKSAAFQIQSFDIVCSPVWTSRDRCCDI
PSRRDEAKCPAFPNSCTCTQDSVGPPGPPGPAGGPGAKGPRGERGISGAVGPPGPRGDIG
PPGPQGPPGPQGPNGLSIPGEQGRQGMKGDAGEPGLPGRTGTPGLPGPPGPMGPPGDRGF
TGKDGAMGPRGPPGPPGSPGSPGVTGPSGKPGKPGDHGRPGPSGLKGEKGDRGDIASQNM
MRAVARQVCEQLISGQMNRFNQMLNQIPNDYHSSRNQPGPPGPPGPPGSAGARGEPGPGG
RPGFPGTPGMQGPPGERGLPGEKGERGTGSPGPRGLPGPPGPQGESRTGPPGSTGSRGPP
GPPGRPGNSGIRGPPGPPGYCDSSQCASIPYNGQGYPGML
Download sequence
Identical sequences ENSMMUP00000025312 9544.ENSMMUP00000025312 ENSMMUP00000025321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]