SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025383 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025383
Domain Number 1 Region: 180-488
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.25e-86
Family DnaQ-like 3'-5' exonuclease 0.000000549
Further Details:      
 
Domain Number 2 Region: 484-580
Classification Level Classification E-value
Superfamily HRDC-like 2.11e-26
Family EXOSC10 HRDC domain-like 0.00000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025383   Gene: ENSMMUG00000019322   Transcript: ENSMMUT00000027134
Sequence length 884
Comment pep:known chromosome:MMUL_1:1:14178512:14209156:-1 gene:ENSMMUG00000019322 transcript:ENSMMUT00000027134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPSTREPRVQSATSATKPDGEMVLPGFPDADSFVKFALGSVVAVTKASGGLPQFGDEY
DFYRSFPGFQAFCETQGDRLLQCMSRVMQYHGCRSNIKDRSKVTELEDKFDLLVDANDVI
LERVGILLDEASGVNKNQQPVLPAGLQVPKTVVSSWNRKAAEYGKKAKSETFRLLHAKNI
IRPQLKFREKIDNSNTPFLPKIFIKPNAQKPLPQALSKERRERPQDRPEDLDVPPALADF
IHQQRTQQVEQDMFAHPYQYELNHFTPPDSVFQKPQPQLYRPIEETPCHFISSLDELVEL
NEKLLNCQEFAVDLEHHSYRSFLGLTCLMQISTRTEDFIIDTLELRSDMYILNESLTDPA
IVKVFHGADSDIEWLQKDFGLYVVNMFDTHQAARLLNLGRHSLDHLLKLYCNVDSNKQYQ
LADWRIRPLPEEMLSYARDDTHYLLYIYDKMRLELWERGNGQPVQLQVVWQRSRDICLKK
FIKPIFTDESYLELYRKQKKHLNTQQLTAFQLLFAWRDKTARREDESYGYVLPNHMMLKI
AEELPKEPQGIIACCNPVPPLVRQQINEMHLLIQQAREMPLLKSEVAAGVKKSGPLPIAE
RLENVLFGPHDCSHAPPDGYPIIPTNGSVPVQKQASLFPEEKEDNLLGTTCLIARAVITL
FNEPSAEDNKKGPLTIAQKKAQNIMESFENPFRMFLPSLGHRAVSQAAKFDPSTKIYEIS
NRWKLAQVQVQKDSKETVKKKAAEQTAAREQAKEACKAAAEQAISVRQQVALENAAKKRE
RATSDPRTTEQKQEKKRLKISKKPKDLEPPEKEFTPYDYSQSDFKAFAGNSKSKAASQFD
PNKQTPSGKKFIAAKKIKQSVGNKSMSFPTGKSDRGFRYNWPQR
Download sequence
Identical sequences F6S2L0
ENSMMUP00000025383 ENSMMUP00000025383 9544.ENSMMUP00000025383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]