SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025440 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025440
Domain Number 1 Region: 10-160
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000267
Family Laminin G-like module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025440   Gene: ENSMMUG00000019365   Transcript: ENSMMUT00000027196
Sequence length 161
Comment pep:known scaffold:MMUL_1:1099213964425:233:1306:-1 gene:ENSMMUG00000019365 transcript:ENSMMUT00000027196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CTPCGFVPGSEVPSFPDGVWRARGICPPTECHKLPNSAHPPSTSSHQADFPKIFLLTVFW
THPGLQPLLTLYSAQGVQQLSLELGQPVCFLYEDQTGRFQPPAQLVFWGLTLVVGKWHHV
ATAVKGRSVTLIVDCKITGSVLDTCGVIILGACILDEEVFE
Download sequence
Identical sequences 9544.ENSMMUP00000025440 ENSMMUP00000025440 ENSMMUP00000025440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]