SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025524 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025524
Domain Number 1 Region: 295-437
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 191-296
Classification Level Classification E-value
Superfamily Second domain of FERM 9.16e-37
Family Second domain of FERM 0.00000293
Further Details:      
 
Domain Number 3 Region: 110-190
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.76e-27
Family First domain of FERM 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025524   Gene: ENSMMUG00000019418   Transcript: ENSMMUT00000027283
Sequence length 1085
Comment pep:known chromosome:MMUL_1:18:8732867:8894952:1 gene:ENSMMUG00000019418 transcript:ENSMMUT00000027283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPSEEQQQALEQFASAAAHSTPVRR
EVTDKEQEFAARAAKQLEYQQLEDDKLSQKSSSSKLSRSPLKIAKKPKSMQCKVILLDGS
EYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAW
HFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDY
DPDECGSDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDL
HHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFE
STIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRRAS
ALIDRPAPYFERSSSKRYTMSRSLDGEVGTGQYATTKGISQTNLITTVTPEKKAEEERDE
EEERRRKGEEVTPVSAIRHEGKSPGLGTDSCPLSPPSAHCAPTSPTELRRRCKENDCKLP
GYEPSRAEHMPGEPALDSDGPGRPYLGDQDVAFSYRQQTGKGTTFSFSLQLPESFPSLLD
DDYLSFPNLSETNLLPQSLQHYLPIRSPSLVPCFLFIFFFLLSASFSVPYALTLSFPLAL
CLCYLEPKAASLSASLDNDPSDSSEEETDSERTDTAADGETTATESDQEEDAELKAQELE
KTQDDLMKHQTNISELKRTFLETSTDTAITNEWEKRLSTSPVRLAARQEDAPMIEPLVPE
ETKQSSGEKLMDGSEIFSLLESARKPTEFIGGVTSTSQSWVQKMETKTESSGIETEPTVH
RLPLSTEKVVQETVLVEERHVVHASGDASYSVGDSGDAAAQPAFTGIKGKEGSALTEGAK
EEGGEEVAKAVLEQEETAAASREQQEEQSAAIHVSETLEQKPHFESSTVKTETISFGSVS
PGGVKLEISTKEVPVVHTETKTITYESSQVDPGTDLEPGVLMSAQTITSETTSTTTTTHI
TKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEITP
EDGED
Download sequence
Identical sequences ENSMMUP00000025524 ENSMMUP00000025524 9544.ENSMMUP00000025524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]