SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025765 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025765
Domain Number 1 Region: 153-283
Classification Level Classification E-value
Superfamily GAT-like domain 5.49e-48
Family Phosphoinositide-binding clathrin adaptor, domain 2 0.000000227
Further Details:      
 
Domain Number 2 Region: 23-148
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.6e-44
Family Phosphoinositide-binding clathrin adaptor, N-terminal domain 0.000000524
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025765   Gene: ENSMMUG00000019618   Transcript: ENSMMUT00000027549
Sequence length 645
Comment pep:known chromosome:MMUL_1:14:84288862:84401039:-1 gene:ENSMMUG00000019618 transcript:ENSMMUT00000027549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLA
DSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDM
STFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKF
LTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKKIKDSTAASRAT
TLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGD
AVDDAIPSLNPFLTKSSGDVHLSISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNV
DFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQSLPVAKLPPNKLVSDDLDSSLANL
VGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMAYPATTPTG
MIGYGIPPQMGSVPVMTQPTLIYSQPVMRPPNPFGPVSGAQIQFM
Download sequence
Identical sequences ENSMMUP00000025765 ENSMMUP00000025765 XP_004090648.1.23891 XP_005579330.1.63531 XP_011840312.1.47321 XP_011930969.1.92194 XP_014970801.1.72884 9544.ENSMMUP00000025765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]