SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025873 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025873
Domain Number 1 Region: 344-691
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.57e-38
Family Hect, E3 ligase catalytic domain 0.011
Further Details:      
 
Domain Number 2 Region: 210-291
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.1e-28
Family PHD domain 0.00083
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000025873
Domain Number - Region: 138-199
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00397
Family PHD domain 0.02
Further Details:      
 
Domain Number - Region: 67-106
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0153
Family PHD domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025873   Gene: ENSMMUG00000019691   Transcript: ENSMMUT00000027661
Sequence length 706
Comment pep:known chromosome:MMUL_1:7:93498391:93558806:1 gene:ENSMMUG00000019691 transcript:ENSMMUT00000027661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNENKPGDSQNLACVFCRKNDDCPNKYGEKKTKEKWNLTVHYYCLLMSSGIWQRGKEEEG
VYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKRSYHFPCGLQRECIFQFTGNF
ASFCWNHRPVQIITSNNYRESLPCTICLEFIEPIPSYNILRSPCCKNAWFHRDCLQVQAI
NAGVFFFRCTICSNSDIFQKEMLRMGIHIPEKDASWELEENAYQELLQHHERCDVRRCRC
KEGRDYNAPDSKWEIKRCQCCGSSGTHLACSSLRSWEQNWECLECRGIIYNSGEFQKAKK
HVLPNSNNVGITDCLLEESSPKLPRQSPGSQSKDLLRQGSKFRRNVSTLLIELGFQIKKK
TKRLYINKANIWTSALDAFRNRNFNPSYAIEVAYVIENDNFGSEHPGSKQEFLSLLMQHL
ENSSLFEGSLSKNLSLNSQALKENLYYEAGKMLAISLVHGGPSPGFFSKTLFNCLVYGPE
NTQPILDDVSDFDVAQIIIRINTATTVADLKSVINECYNYLELIGCLRLITTLSDKYMLV
KDILVYHVIQRVQAPFESFKQGLKTLGVLEKIQAYPEAFCSILCHKPESLSAKILSDLFT
VHTLPDVKALGFWNSYLQAVEDGKSTTTMEDILIFATGCSSIPPAGFKPTPSIECLPVDF
PVGNKCNNCLAIPVTNTYKEFQENMDFTIRNTLKLEKEESSHYIGH
Download sequence
Identical sequences A0A2K6C6K7 G7PA10 Q4R9C4
NP_001181581.1.72884 XP_001114675.1.72884 XP_011733089.1.29376 XP_011733090.1.29376 XP_011733091.1.29376 XP_011733093.1.29376 XP_011733094.1.29376 XP_014998963.1.72884 XP_014998964.1.72884 ENSMMUP00000025873 ENSMMUP00000025873 9544.ENSMMUP00000025873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]