SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025926 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025926
Domain Number 1 Region: 568-769
Classification Level Classification E-value
Superfamily Fibronectin type III 1.34e-40
Family Fibronectin type III 0.0000541
Further Details:      
 
Domain Number 2 Region: 1176-1372
Classification Level Classification E-value
Superfamily Fibronectin type III 3.71e-39
Family Fibronectin type III 0.0000143
Further Details:      
 
Domain Number 3 Region: 769-958
Classification Level Classification E-value
Superfamily Fibronectin type III 7.94e-35
Family Fibronectin type III 0.0000339
Further Details:      
 
Domain Number 4 Region: 968-1176
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-34
Family Fibronectin type III 0.0000181
Further Details:      
 
Domain Number 5 Region: 1707-1902
Classification Level Classification E-value
Superfamily Fibronectin type III 2.34e-33
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 6 Region: 1376-1521
Classification Level Classification E-value
Superfamily Fibronectin type III 4.8e-29
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 7 Region: 1554-1708
Classification Level Classification E-value
Superfamily Fibronectin type III 1.38e-27
Family Fibronectin type III 0.00058
Further Details:      
 
Domain Number 8 Region: 379-471
Classification Level Classification E-value
Superfamily Immunoglobulin 4.64e-21
Family I set domains 0.0085
Further Details:      
 
Domain Number 9 Region: 278-377
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-19
Family I set domains 0.021
Further Details:      
 
Domain Number 10 Region: 477-573
Classification Level Classification E-value
Superfamily Immunoglobulin 6.69e-18
Family I set domains 0.023
Further Details:      
 
Domain Number 11 Region: 193-290
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000028
Family I set domains 0.028
Further Details:      
 
Domain Number 12 Region: 15-88
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000281
Family I set domains 0.012
Further Details:      
 
Domain Number 13 Region: 94-168
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000203
Family I set domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025926   Gene: ENSMMUG00000019724   Transcript: ENSMMUT00000027717
Sequence length 2033
Comment pep:known chromosome:MMUL_1:3:41616273:42246060:1 gene:ENSMMUG00000019724 transcript:ENSMMUT00000027717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDVAPYFKTEPGLPQIHLEGNRLVLTCLAEGSWPLEFKWMRDGRELTTYSSEYKYIIPSL
QKLDAGFYRCVVRNRMGALLQRKSEVQVAYMGSFTDTDQRKTVPQGRAAILNLLPITSYP
RPQVTWFREGHKIIPSNRIAITLENQLVILATTASDAGAYYVQAVNEKNGENKTSPFIHL
SIARDIGTPETTAPTIVVPPGNRSVVAGSSETTLECIASARPVEDLSVTWKRNGVRITSG
LHSFGRRLTISNPTSADTGLYVCEAALLGSAFEPARAKAFLFITEPPYFTAEPESRISAE
VEETVDIRCQAMGVPLPTLQWYKDAISISRLQNPRYKVLASGGLRIQKLRPEDSGIFQCF
ASNEGGEIQTHTYLDVTNIAPVFTQRPADTTVTDGMTAILRCEVSGAPKPAITWKRENHI
LASGSVRIPRFMLLESGGLQIAPVFIQDAGNYTCYAANTEGSLNASATLTVWNRTSIVHP
PEDHVVIKGTTATLHCGATHDPRVSLRYVWKKDNVALTPSSTSRIVVEKDGSLLISQTWS
GDIGDYTCEIVSEGGNDSRMARLEVIELPHSPQNLLASPNSSHSHAVVLSWVRPFDGNSP
ILYYIVELSENNSPWKVHLSNVGPEMTGVTVGGLTPARTYQFRVCAVNEVGRGQYSAETS
RLMLPEEPPSAPPKNIVASGRTNQSIMVQWQPPPETEHNGVLRGYILYRLAGLPGEYQQR
NITSPEVNYCLVTDLIIWTQYEIQVAAYNGAGLGVFSRAVTEYTLQGVPTAPPQNVQTEA
VNSTTIQFLWNPPPQQFINGINQGYKLLAWPADAPEAVTVVTIAPDFHGVHHGHVTNLKK
FTAYFTSVLCFTTPGDGPPSTPQLVWTHEDKPGAVGHLSFTEILDTSLKVSWQEPLEKNG
IITGYQISWEVYGRNDSRLTHTLNSTTHEYKIQGLSSLTTYTIDVAALTAVGAGLLTSST
ISSGVPPDLPGAPSNLVISNISPRSATLQFRPGYDGKTSISRWIVEGQVGAIGDEEEWVT
LYEEENEPDAQTLEIPNLTPYTHYRFRMKQVNIVGPSPYSQSSRVIQTLQAPPDVAPTSV
TVRTASETSLRLRWVPLPDSQYNGNPESVGYRIKYWRSDLQSSALAQVVSDRLEREFTIE
ELEEWMEYELQMQAFNAVGAGPWSEVVRGRTRESVPSAAPENVSAEAVSSTQILLTWASV
PEQDQNGLILGYKILFRAKDLDPEPRSHTVRGNYTQSALLAGLRKFVLYELQVLAFTRIG
NGVPSTPLILERTKDDAPGPPVRLVFPEVRLTSVRIVWQPPEEPNGIILGYQIAYRLASS
SPHTFTTVEVGATVRQFTATDLAPESAYIFRLSAKTRQGWGEPLEATVITTEKRERPAPP
RELLVPQAEVTARSLRLQWVPGSDGASPIRYFTVQVRELPRGEWQTYSSSISHEATACIV
DRLRPFTSYKLRLKATNDIGDSDFSSETEAVTTLQDVPGEPPGSVSATPHTTSSVLIQWQ
PPRDESLNGLLQGYRIYYRELEYEAGSGTEAKTLKSPIALRAELTAQSSFKTVNSSSTST
MCELTHLKKYRRYEVIMTAYNIIGESPASAPVEVFVGEAAPAMAPQNVQVTPLTASQLEV
TWDPPPPESQNGNIQGYKARPSRAIYYWEADSQNDTEKMKVLFLPEPVVRLKNLTSHTEY
LVSISAFNAAGDGPRSDPRQGRTHQAAPGAPSFLAFSEITSTTLNVSWGEPAAANGILQG
YRVVYEPLAPVQGVSKVVTVEVRGNWQRWLKVRDLTKGVTYFFRVQARTITYGPELQANV
TAGPAEGSPGSPRDVLVTKSASELTLQWTEGHSGDTPTTGYVIEARPSDEGLWDMFVKDI
PRSATSYTLSLDKLRQGVTYEFRVVAVNEVGYGEPSSPSTAVSAQVEAPFYEEWWFLLVM
ALSSLIVILLVVFALVLHGQNKKYKNCSTGKGISTMEESVTRDNGGFAALELSSRHLNVK
STFSKKNGTRSPPRPSPGGLHYSDEDICNKYNGAVLTESVSLKEKSADASESE
Download sequence
Identical sequences ENSMMUP00000025926 9544.ENSMMUP00000025926 ENSMMUP00000025926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]